KEGG   Plasmodium yoelii: PY17X_1340500Help
Entry
PY17X_1340500     CDS       T01035                                 

Gene name
PY04296
Definition
(RefSeq) protein disulfide-isomerase, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_9 TraF
Motif
Other DBs
NCBI-GeneID: 3789891
NCBI-ProteinID: XP_022813648
Position
13
AA seq 543 aa AA seqDB search
MKYINLLIPFFILINFYYTGQDNLGKKEIVSINMDTFNQILEDEDQITLLIVYTHWCQRS
ILLLENLENISSILMYDSNINISKINVAINHEIIHIFDVYSYPSLFLIKKKQVYKYIGLN
NVQSILLWVQEYLDESIYEIKNKEKLVLFLELKEYNISTIFFIIKEKKYYNMINDLISIC
KLIENTFCFYIKDNDLISFFENAFVAKSDNLNITEIKEKEIYGILYKNDFFDKYFYPFNN
SLNILYENESSADDKLNALAKWINEKSEPLVIRFSEYYFSTLFSPETIALFIFYNDINEL
NKTDIIKCAKKHKMVTFAISGNVEVYEKRLLSDLLIDDVQKPIMRITQFKNDIEIPYKYK
PLSDEVEINEKTIDQFINEFLTDNKYFYKKSERILPDEYNNGYVKIIVADNYDEHIFNND
KNVVVLYYAPWCGHCHKFDPIYRRIGKRLKLYINQNEDYKDDVIISKIDAANNEIYNVPI
EGYPTIYLYEKSNKRIPIMYTEEKTEENLISWICRMTNTNINIEKFLSINLDDEKLFENY
EEL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacataaatttattaataccgttttttattttaataaatttttattatacgggt
caggataatttagggaaaaaagaaatagtgtctataaatatggacacttttaatcaaatt
ttagaggatgaagatcaaattacattattaatagtatatacccattggtgtcaaagatct
attttacttcttgaaaatttagaaaatatatcaagtatattaatgtatgatagtaatata
aatatatcaaaaataaatgttgctatcaatcatgaaataatacatatatttgatgtatat
agttacccttccttatttttaataaaaaaaaaacaagtatataaatatatcggtttaaat
aatgtacaaagcatattattatgggtacaagaatacttagatgaaagtatatatgaaata
aaaaataaagagaaattagttttatttttagaattaaaagaatataatatatctactata
ttttttataataaaagaaaaaaaatattataatatgatcaatgatttaatttctatatgt
aaattaatagaaaatacattttgtttttatattaaagacaatgatttaatttcatttttt
gaaaatgcttttgttgcaaaaagtgataacttaaatataactgaaattaaagaaaaagaa
atatatggaattttatataaaaatgatttttttgataaatatttttatccttttaataat
tcattaaatatattatatgaaaatgagtctagtgcggatgataaactaaatgcattagca
aaatggataaacgaaaaaagtgaacctttagttattcgtttttcggaatattatttttcg
actttattttcacccgaaacaattgcattatttatattttataatgatattaatgagtta
aataaaaccgatattattaagtgtgcaaaaaaacataaaatggttacttttgctatttct
gggaatgtagaagtatatgaaaagcggttattgtctgatctccttattgatgatgtacaa
aaaccgattatgagaattacccaatttaaaaatgatatagaaattccttacaagtacaag
cctttgtcggatgaggtcgagataaacgaaaagacaattgaccagtttattaatgaattt
ctaacggataataaatacttttacaaaaaaagtgagcgtattttaccagacgaatataat
aatggatatgtgaaaataatagtagcagacaattacgatgaacatatatttaataatgat
aaaaatgttgtagttctatattatgcaccttggtgtgggcattgccataaatttgaccca
atctatagaagaataggaaaaagattaaaattgtatataaatcaaaatgaagattataaa
gatgatgttataattagtaaaattgatgcagctaataatgaaatatataatgttcccatt
gagggatatccaaccatttatttgtatgaaaaatctaataaaagaattcctataatgtat
actgaagagaaaactgaagaaaaccttatttcttggatttgtcgaatgacaaacacaaat
ataaatattgagaaatttctttccataaatttagatgatgaaaagctttttgagaattac
gaagaattatag

DBGET integrated database retrieval system