KEGG   Plasmodium yoelii: PY04296Help
Entry
PY04296           CDS       T01035                                 

Definition
protein disulfide isomerase precursor
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PY04296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 520 aa AA seqDB search
MKYINLLIPFFILINFYYTGQDNLGKKEIVSINMDTFNQILEDEDQITLLIVYTHWCQRS
ILLLENLENISSILMYDSNINISKINVAINHEIIHIFDVYSYPSLFLIKKKQVYKYIGLN
NVQSILLWVQEYLDESIYEIKNKEKLVLFLELKEYNISTIFFIIKEKKYYNMINDLISIC
KLIENTFCFYIKDNDLISFFENAFVAKSDNLNITEIKEKEIYGILYKNDFFDKYFYPFNN
SLNILYENESSADDKLNALAKWINEKSEPLVIRFSEYYFSTLFSPETIALFIFYNDINEL
NKTDIIKCAKKHKMVTFAISGNVEVYEKRLLSDLLIDDVQKPIMRITQFKNDIEIPYKYK
PLSDEVEINEKTIDQFINEFLTDNKYFYKKSERILPDEYNNGYVKIIVADNYDEHIFNND
KNVVVLYYAPWCGHCHKFDPIYRRIGKRLKLYINQNEDYKDDVIISKIDAANNEIYNVPI
EGYPTIYLYEKSNKRIPIMYTEEKTEENLISWICRMGIKR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacataaatttattaataccgttttttattttaataaatttttattatacgggt
caggataatttagggaaaaaagaaatagtgtctataaatatggacacttttaatcaaatt
ttagaggatgaagatcaaattacattattaatagtatatacccattggtgtcaaagatct
attttacttcttgaaaatttagaaaatatatcaagtatattaatgtatgatagtaatata
aatatatcaaaaataaatgttgctatcaatcatgaaataatacatatatttgatgtatat
agttacccttccttatttttaataaaaaaaaaacaagtatataaatatatcggtttaaat
aatgtacaaagcatattattatgggtacaagaatacttagatgaaagtatatatgaaata
aaaaataaagagaaattagttttatttttagaattaaaagaatataatatatctactata
ttttttataataaaagaaaaaaaatattataatatgatcaatgatttaatttctatatgt
aaattaatagaaaatacattttgtttttatattaaagacaatgatttaatttcatttttt
gaaaatgcttttgttgcaaaaagtgataacttaaatataactgaaattaaagaaaaagaa
atatatggaattttatataaaaatgatttttttgataaatatttttatccttttaataat
tcattaaatatattatatgaaaatgagtctagtgcggatgataaactaaatgcattagca
aaatggataaacgaaaaaagtgaacctttagttattcgtttttcggaatattatttttcg
actttattttcacccgaaacaattgcattatttatattttataatgatattaatgagtta
aataaaaccgatattattaagtgtgcaaaaaaacataaaatggttacttttgctatttct
gggaatgtagaagtatatgaaaagcggttattgtctgatctccttattgatgatgtacaa
aaaccgattatgagaattacccaatttaaaaatgatatagaaattccttacaagtacaag
cctttgtcggatgaggtcgagataaacgaaaagacaattgaccagtttattaatgaattt
ctaacggataataaatacttttacaaaaaaagtgagcgtattttaccagacgaatataat
aatggatatgtgaaaataatagtagcagacaattacgatgaacatatatttaataatgat
aaaaatgttgtagttctatattatgcaccttggtgtgggcattgccataaatttgaccca
atctatagaagaataggaaaaagattaaaattgtatataaatcaaaatgaagattataaa
gatgatgttataattagtaaaattgatgcagctaataatgaaatatataatgttcccatt
gagggatatccaaccatttatttgtatgaaaaatctaataaaagaattcctataatgtat
actgaagagaaaactgaagaaaaccttatttcttggatttgtcgaatgggtataaaaaga
tag

DBGET integrated database retrieval system