KEGG   Plasmodium yoelii: PY04306Help
Entry
PY04306           CDS       T01035                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pyo  Plasmodium yoelii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PY04306
   01230 Biosynthesis of amino acids
    PY04306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PY04306
   00051 Fructose and mannose metabolism
    PY04306
   00562 Inositol phosphate metabolism
    PY04306
Enzymes [BR:pyo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PY04306
Exosome [BR:pyo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PY04306
  Exosomal proteins of bladder cancer cells
   PY04306
  Exosomal proteins of melanoma cells
   PY04306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 210 aa AA seqDB search
VVVFPVSVHYDLTRKLLNKKIGTGIQNVSKFGNGSYTGEVSAEIAKNLNIEYVLIGHFER
RKYFNETDEDVRQKLQQAIKNNLKAVVCFGESLEQRESNKTIDVITKQVKAFVDLIENFD
NVILAYEPIWAIGTGKTATPEQAQEVHKEIRKIVKEMCGEAQANKIRILYGGSVSVENCT
SLIKQEDIDGFLVGTSSLKTSFTEIIKSAM
NT seq 635 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgtattccctgtaagtgtacactatgatcttactagaaaattattaaataaaa
aaataggaactggtatacaaaatgtttcaaaatttggaaatggttcatatactggtgaag
ttagtgcagaaattgcaaaaaacttaaatatcgaatatgttttaattggccattttgaaa
gaagaaaatattttaatgaaactgatgaagatgtaaggcaaaagctacaacaagctatca
aaaataatttaaaagctgttgtgtgttttggtgaatcactagaacaaagagaatccaaca
aaactatcgatgtaatcacaaaacaagtaaaagcttttgttgatttaattgaaaactttg
ataatgtcatattagcttatgaacctatctgggctattggaaccggaaaaacagccacac
cagagcaagcacaagaagttcataaagaaattagaaaaattgtaaaagaaatgtgtggag
aagctcaagcaaataaaatcagaattttatacggaggtagtgttagcgttgaaaattgta
cttcattaattaagcaagaagatatcgatggtttcttagttggaacaagctcattaaaga
cctcattcactgaaattataaaatctgccatgtaa

DBGET integrated database retrieval system