KEGG   Plasmodium yoelii: PY04400Help
Entry
PY04400           CDS       T01035                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme l5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 419 aa AA seqDB search
MQSENDSIGEWCLIESNPCIFYEMLKQMGAKNLSAEDVYDLDHFDNYINNKDEIKIEHIL
SIQEYRSEKEKEAGLKSKMETEPYNSDIDLEDKYNKLLNNFSHVFGIIFLFNIGKSYDRK
KYKEHNIPENLFFAKQVIPNACATQAILSIIFNKNIKLNENIENIKTFSINFDSTMKGLT
LSNCNFLRNIHNSFKTPVYIENDDLYHNKKKESNSFHFVSYIEFEKNVYLLDGLQEGPIL
ITDKNDDEKKEIENNWINIARNHIKKDINIMSNSEDDTENRFNILAIIKDKECIINEYIN
IHRIFKQRISVKLISLGENIEFDDEINEDDYYFSNKIPSIDQLTSNIEKLHNILKKSSNE
INFLENLLTKEIELKASWDKERTFKFYNFYPFIISSIDLMAKHKILKPSYEKEKQKRNN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgaaaatgatagcattggggaatggtgcttaattgagagtaatccctgcata
ttttatgagatgttaaaacagatgggagcaaaaaatttatcagcagaagatgtatatgat
ttagatcattttgataattatataaataataaagatgaaataaaaattgaacatatatta
agcatacaagaatacagaagtgaaaaagaaaaagaagcaggtttaaagtcaaaaatggaa
acagaaccatataatagtgacatagatttagaagataaatataataagcttttaaataat
ttttctcatgtatttggaataatatttttatttaatattggaaaaagttatgatcgaaaa
aaatataaagaacataatattcctgaaaatttattttttgctaaacaagtcattccgaat
gcatgtgcaacacaagctatattatctattatatttaataaaaatataaaattaaatgaa
aatatagaaaatataaaaacgtttagtataaattttgatagtactatgaaagggttaaca
ttatctaattgtaattttttacgaaatattcataattcttttaaaacgccagtatatata
gaaaatgatgatttatatcataacaaaaaaaaagaatcaaattcttttcattttgtatca
tatattgaatttgaaaaaaatgtatatttattagatgggttacaagaaggcccaatatta
attactgataaaaatgatgatgaaaaaaaagaaatagaaaataactggataaatatagca
cgaaatcatataaaaaaagatataaacattatgagcaatagtgaagatgatacagaaaat
cgatttaatattttggcaataataaaagataaggaatgtataattaatgaatatataaat
atacatagaatatttaaacaaagaataagtgttaaactaataagtttaggagaaaatata
gaattcgatgatgaaataaatgaagatgattattatttttctaataaaatacctagtatt
gatcaacttacatctaatattgaaaaattacataatattttaaaaaaatcatctaatgaa
attaattttttagaaaatcttttgactaaagaaatagaacttaaagcttcttgggataaa
gaacgaacttttaaattttataatttttaccctttcataatatcttcaatcgatttaatg
gctaaacataaaatcttgaaaccgtcttacgaaaaagaaaaacaaaaacgaaataattga

DBGET integrated database retrieval system