KEGG   Plasmodium yoelii: PY04573Help
Entry
PY04573           CDS       T01035                                 

Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pyo  Plasmodium yoelii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PY04573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PY04573
   00020 Citrate cycle (TCA cycle)
    PY04573
   00620 Pyruvate metabolism
    PY04573
Enzymes [BR:pyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PY04573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MMRYFIFFLAFWLNIYKCINNIKNRNSYGFINLNNNLKLHHKNKHVLYSKVEIKMPALSS
TMTSGKIVRWNKSVGEFINVGDIIMTVESDKADMDVESFDEGYLRRKLIEEGSEANVGDV
LGILTTEENEEVANEEAENEKTTDVEMSDVETTSVETADVETTDVEGESVEKGIYSPSVQ
SKKNKVRIAKWLCKENEFVNKSDVIFHIEDDKSTIEVDSPYTGIIKTILVKEGELADLEK
QVATILETNELENTSMNLSSEADPKTIKEHAQHNQEHGISHERIVLPSAIELMKKHKLTP
EDITHTTIPNRITYEDVNMFLEKKKKIPKVGSDTRVEGGGRVVKLTNIQKSIKNNMMLTL
NVPVFRITHLIKTCQLLKIYEQVKDKISMSVILNKCVSLALLKNPLIYSTYIDNENGEIL
YNQNINIGNALGLNDCLLTPVLKNVDKKDIYTLSTEWKDLVKKGKSGTLSANEMSGSNFF
ISNLGMFNTYQFDAILPKNASCILSIGTNIVSINQFEDLKINKGIMMTLTCDHRHIYGSH
AAIFMNDLANVIENSIMDIFL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgatactttattttttttcttgcattttggttaaatatttataaatgtattaac
aacattaaaaatagaaatagttatggattcataaatttaaataataatttgaaactgcat
cataaaaataaacatgttctctattcgaaagttgaaattaaaatgcctgccctatctagt
accatgacgagtggcaaaattgttcgctggaataaaagcgttggagaatttattaacgtt
ggggatataattatgacagtagaaagtgataaagcagatatggatgttgaatcgtttgat
gaaggatatttaagacgaaaactaatcgaagaagggtctgaagcaaatgttggagatgta
ctaggaattctaacgactgaggaaaatgaagaagtggcaaatgaagaggcggaaaatgaa
aagacgacagatgtagagatgtcagatgtagaaacaacaagtgtagagacggcagatgta
gagacgacagatgtagaaggggaaagtgtggaaaaagggatatacagtccatcagtgcaa
agtaaaaaaaataaagtaagaatcgctaaatggttatgtaaagaaaacgaatttgtgaat
aaatctgatgttatatttcacattgaagatgacaaaagtacaattgaagtggatagtcct
tatacaggtataataaaaactattttagtaaaagaaggagagcttgcagatttggaaaaa
caagttgccaccattttagaaacaaatgaactggaaaacacctctatgaatttatcttct
gaagcagaccctaaaaccatcaaggaacatgcacagcacaaccaagaacatggaatatct
catgaaagaatagtattgccatctgccattgaacttatgaagaaacacaaactaaccccc
gaagatatcacgcacacgaccataccgaacagaatcacctacgaagatgtcaacatgttt
ctcgaaaaaaaaaaaaaaattccaaaagtaggaagcgatacaagagtagaagggggaggg
cgagttgtcaaattaacgaatatacaaaagtcaataaaaaataatatgatgctaacatta
aatgttccagtatttcgaataacacatttaataaaaacttgtcaattattaaaaatatat
gaacaagtcaaagataaaataagtatgtcagtcatattaaataaatgtgtatctttggca
ttacttaaaaatccattaatatattcaacatatatagataatgaaaatggagaaatttta
tataaccaaaatataaatataggaaatgcattaggattgaacgattgtttattaacccct
gttttaaaaaatgtcgataaaaaagatatatatacattatcaacagaatggaaagatctg
gtaaaaaaaggaaaaagtggaaccctttcagcaaatgaaatgtcgggaagcaattttttt
atttcgaatttaggaatgtttaacacatatcaatttgatgctatcttaccaaaaaatgca
tcatgtattttatctatcggtacaaatatagttagcataaatcaatttgaagatttaaaa
ataaataaaggaataatgatgacattaacatgtgaccatagacatatttatggttcacat
gctgctatttttatgaacgatttagcaaatgtcattgaaaatagtataatggacatattt
ttataa

DBGET integrated database retrieval system