KEGG   Plasmodium yoelii: PY17X_1103900Help
Entry
PY17X_1103900     CDS       T01035                                 

Gene name
PY04665
Definition
(RefSeq) 4-diphosphocytidyl-2c-methyl-D-erythritol kinase (CMK), putative
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00900  Terpenoid backbone biosynthesis
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PY17X_1103900 (PY04665)
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PY17X_1103900 (PY04665)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF870
Motif
Other DBs
NCBI-GeneID: 3790329
NCBI-ProteinID: XP_724994
Position
11
AA seq 524 aa AA seqDB search
MKICLQIKFVIYIFINYVARNVESKNVPNKSTKFVIKLSKDTKGVDLKNCFINQYNKIIN
ERCVHKNSGIVKNGIVKSGIVKSGIVKMNDDSLKCLKGIYSNIENDNNDSENEHVYKKGN
ILCNEKMKLLIKILNTKKWYDLKLFSPGKINLFLRLKEKKENFNELSTLMHAINLGDDIF
IKALNKNEQEKLSPILYPCLSGDFLTIEEDKTKEHDIIKENRKVCEKNETGKYEYMNYPL
NDSNIIIKVLKKYRKDLNINDNIRFLIHIKKRIPIFSGIGGGSSNGASVFYYLEKYFYKY
LKTNELKNNFLKEIGSDISFFSSSGFAYCTGKGNNIIDLANFDVIISEKKIYLFKIGEGL
SSKLVYQNVDYEKIIQYNPISLLEKFICNLRSNLNNKDKNNIIEIVKKSEENYMKKFINK
NLDIQNMFVNDLEIPAFFLLKKIKYLKDFLASQNIFDVVTMSGSGSSLFAITKNNENLNP
NKIKELIKQAEKNFNINIKVYSCQVIRKNENSWYHSDKLAEVIV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctgcctacaaataaaatttgtaatatatatttttataaattatgttgccaga
aatgttgaatcaaaaaatgttcctaacaaaagtaccaagtttgtaataaaattaagtaaa
gacactaaaggggtggatttaaaaaattgttttattaatcaatataataagatcattaat
gaaagatgtgtgcataaaaatagtggcatagtgaaaaatggcatagtgaaaagtggcata
gtgaaaagtggcatagtgaaaatgaatgatgacagtcttaaatgcttaaaaggaatttat
tcaaatatagagaacgataataatgatagtgaaaatgagcatgtgtataaaaaagggaat
atattatgtaacgaaaaaatgaaattgttaataaaaatattaaatacaaaaaaatggtat
gatttaaagcttttttctccaggaaaaattaatttatttttaagattaaaagagaaaaaa
gaaaattttaatgaattatcaacactaatgcatgctataaatttaggagatgatattttt
ataaaagctttaaataaaaatgaacaagaaaaattatcaccaatattatatccatgttta
tcaggagattttctaacaatagaagaagataaaactaaagaacatgatataataaaagaa
aatagaaaagtgtgtgaaaaaaatgaaacaggtaaatatgaatacatgaattatccatta
aatgatagtaatataataataaaagttttgaaaaaatatagaaaagatttaaatataaat
gataatataagatttttaattcatattaaaaaaaggataccaatttttagtggaattggt
ggtggttcatcaaatggagcttcagttttttattatttagaaaaatatttttataaatat
ttaaaaacaaatgaattaaaaaataattttttaaaagaaataggaagtgatataagtttt
tttagtagctcaggatttgcttattgtacaggaaaaggaaataatataattgatttagca
aattttgatgttattatatcagaaaaaaaaatatatttatttaaaattggtgaaggacta
tcatcaaaattagtttatcaaaatgtagattatgaaaaaataatacaatacaatccgatt
agtttgttagagaaatttatttgcaatttaagaagcaacttaaacaataaggataaaaat
aatataattgaaattgtgaaaaaaagcgaagaaaattatatgaaaaaatttattaataaa
aatttggatatacaaaatatgtttgtaaatgatttagaaattcctgctttttttttgctt
aaaaaaataaaatatttaaaagattttttagctagccaaaatatctttgatgttgtaaca
atgagtggaagtggatcatcgttatttgcaattacaaaaaataatgaaaatttaaatcca
aataaaattaaagagttaattaaacaagctgaaaaaaattttaatattaatataaaagtg
tattcatgtcaagttataagaaaaaatgaaaattcatggtatcattcagacaaattagct
gaagttatagtataa

DBGET integrated database retrieval system