KEGG   Plasmodium yoelii: PY04665Help
Entry
PY04665           CDS       T01035                                 

Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ec 2.7.1.148) (cmk) (4-(cytidine-5'-diphospho)-2-c-methyl-d-erythritol kinase)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pyo  Plasmodium yoelii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PY04665
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PY04665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 540 aa AA seqDB search
MKICLQIKFVIYIFINYVARNVESKNVPNKSTKFVIKLSKDTKGVDLKNCFINQYNKIIN
ERCVHKNSGIVKNGIVKSGIVKSGIVKMNDDSLKCLKGIYSNIENDNNDSENEHVYKKGN
ILCNEKMKLLIKILNTKKWYDLKLFSPGKINLFLRLKEKKENFNELSTLMHAINLGDDIF
IKALNKNEQEKLSPILYPCLSGDFLTIEEDKTKEHDIIKENRKVCEKNETGKYEYMNYPL
NDSNIIIKVLKKYRKDLNINDNIRFLIHIKKRIPIFSGIGGGSSNGASVFYYLEKYFYKY
LKTNELKNNFLKEIGSDISFFSSSGFAYCTGKGNNIIDLANFDVIISEKKIYLFKIGEGL
SSKLVYQNVDYEKIIQYNPISLLEKFICNLRSNLNNKDKNNIIEIVKKSEENYMKKFINK
NLDIQNMFVNDLEIPAFFLLKKIKYLKDFLASQNIFDVVTMSGSGSSLFAITKNNENLNP
NKIKELIKQAEKNFNINIKVYSCQVIRKNENSWDIFIFIIILVFIHTFLLFFTEIRKNMR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctgcctacaaataaaatttgtaatatatatttttataaattatgttgccaga
aatgttgaatcaaaaaatgttcctaacaaaagtaccaagtttgtaataaaattaagtaaa
gacactaaaggggtggatttaaaaaattgttttattaatcaatataataagatcattaat
gaaagatgtgtgcataaaaatagtggcatagtgaaaaatggcatagtgaaaagtggcata
gtgaaaagtggcatagtgaaaatgaatgatgacagtcttaaatgcttaaaaggaatttat
tcaaatatagagaacgataataatgatagtgaaaatgagcatgtgtataaaaaagggaat
atattatgtaacgaaaaaatgaaattgttaataaaaatattaaatacaaaaaaatggtat
gatttaaagcttttttctccaggaaaaattaatttatttttaagattaaaagagaaaaaa
gaaaattttaatgaattatcaacactaatgcatgctataaatttaggagatgatattttt
ataaaagctttaaataaaaatgaacaagaaaaattatcaccaatattatatccatgttta
tcaggagattttctaacaatagaagaagataaaactaaagaacatgatataataaaagaa
aatagaaaagtgtgtgaaaaaaatgaaacaggtaaatatgaatacatgaattatccatta
aatgatagtaatataataataaaagttttgaaaaaatatagaaaagatttaaatataaat
gataatataagatttttaattcatattaaaaaaaggataccaatttttagtggaattggt
ggtggttcatcaaatggagcttcagttttttattatttagaaaaatatttttataaatat
ttaaaaacaaatgaattaaaaaataattttttaaaagaaataggaagtgatataagtttt
tttagtagctcaggatttgcttattgtacaggaaaaggaaataatataattgatttagca
aattttgatgttattatatcagaaaaaaaaatatatttatttaaaattggtgaaggacta
tcatcaaaattagtttatcaaaatgtagattatgaaaaaataatacaatacaatccgatt
agtttgttagagaaatttatttgcaatttaagaagcaacttaaacaataaggataaaaat
aatataattgaaattgtgaaaaaaagcgaagaaaattatatgaaaaaatttattaataaa
aatttggatatacaaaatatgtttgtaaatgatttagaaattcctgctttttttttgctt
aaaaaaataaaatatttaaaagattttttagctagccaaaatatctttgatgttgtaaca
atgagtggaagtggatcatcgttatttgcaattacaaaaaataatgaaaatttaaatcca
aataaaattaaagagttaattaaacaagctgaaaaaaattttaatattaatataaaagtg
tattcatgtcaagttataagaaaaaatgaaaattcatgggatatttttatattcattata
atacttgtatttattcatacttttttattattttttacggaaatcagaaaaaatatgaga
taa

DBGET integrated database retrieval system