KEGG   Plasmodium yoelii: PY17X_0415700Help
Entry
PY17X_0415700     CDS       T01035                                 

Gene name
PY04859
Definition
(RefSeq) translation initiation factor 4E, putative
  KO
K03259  
translation initiation factor 4E
Organism
pyo  Plasmodium yoelii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PY17X_0415700 (PY04859)
Messenger RNA biogenesis [BR:pyo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PY17X_0415700 (PY04859)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PY17X_0415700 (PY04859)
Translation factors [BR:pyo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PY17X_0415700 (PY04859)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 227 aa AA seqDB search
MKYLTFNKSSKDAFDLNEKIEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLTQRSMTRFSDDGIFRIVDALMIFRDNIQPMWEDPAN
AGGGHFEYKILPKDFPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDENVRNHLRKDLEEHMCNRIDGSHVYPPRVKSLSHVHK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctaacttttaataagagcagcaaagatgcatttgatttaaatgaaaaaatt
gaagcaacgaagatcgatttatcaaatcccttattgttacaatataattgggtaatatgg
gaacaagtttctgataataaaattaaacaaagtaataattataaggattatacaagacca
ttagcaaaatttaatagcgttcaaaaattttggcaattatggaatagattacctcaacca
agtgatttacttacacaaagaagtatgaccagattctcagatgatgggatatttcgtatt
gtggatgctcttatgatttttagagataatattcaaccaatgtgggaagacccagccaat
gctggagggggacattttgaatataagatattaccaaaagattttccatatagtcaaata
gatgaattttggaataatcttgttcttgcaattattggttgtagtttaaaacattatgat
ttaataacaggaattagattagttgataaattaagtacaacacgttatggttatataaga
atagaaatatggtatactacaataacagatgaaaatgttagaaatcatttaagaaaagat
cttgaagaacacatgtgtaatcgtatagatggttcgcatgtttatcccccaagagtcaaa
agtcttagtcacgtacataagtaa

DBGET integrated database retrieval system