KEGG   Plasmodium yoelii: PY04859Help
Entry
PY04859           CDS       T01035                                 

Definition
initiation factor E4
Orthology
K03259  
translation initiation factor 4E
Organism
pyo  Plasmodium yoelii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PY04859
Translation factors [BR:pyo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PY04859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MKYLTFNKSSKDAFDLNEKIEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLTQRSMTRFSDDGIFRIVDALMIFRDNIQPMWEDPAN
AGGGHFEYKILPKDFPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDENVRNHLRKDLEEHMCNRIDGSHVYPPRVKSLSHVHKIRITLEFIYNPYY
LFLWVFIFFFF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctaacttttaataagagcagcaaagatgcatttgatttaaatgaaaaaatt
gaagcaacgaagatcgatttatcaaatcccttattgttacaatataattgggtaatatgg
gaacaagtttctgataataaaattaaacaaagtaataattataaggattatacaagacca
ttagcaaaatttaatagcgttcaaaaattttggcaattatggaatagattacctcaacca
agtgatttacttacacaaagaagtatgaccagattctcagatgatgggatatttcgtatt
gtggatgctcttatgatttttagagataatattcaaccaatgtgggaagacccagccaat
gctggagggggacattttgaatataagatattaccaaaagattttccatatagtcaaata
gatgaattttggaataatcttgttcttgcaattattggttgtagtttaaaacattatgat
ttaataacaggaattagattagttgataaattaagtacaacacgttatggttatataaga
atagaaatatggtatactacaataacagatgaaaatgttagaaatcatttaagaaaagat
cttgaagaacacatgtgtaatcgtatagatggttcgcatgtttatcccccaagagtcaaa
agtcttagtcacgtacataaaatacgaattacccttgaattcatttataacccatattat
ttgtttctatgggtatttatatttttttttttttag

DBGET integrated database retrieval system