KEGG   Plasmodium yoelii: PY17X_1111900Help
Entry
PY17X_1111900     CDS       T01035                                 

Gene name
PY04895
Definition
(RefSeq) stearoyl-CoA desaturase, putative
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
pyo  Plasmodium yoelii
Pathway
pyo01040  Biosynthesis of unsaturated fatty acids
pyo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PY17X_1111900 (PY04895)
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PY17X_1111900 (PY04895)
Lipid biosynthesis proteins [BR:pyo01004]
 Desaturase
  First
   PY17X_1111900 (PY04895)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_repr_REX1B
Motif
Other DBs
NCBI-GeneID: 3790613
NCBI-ProteinID: XP_725271
UniProt: A0A077Y5X0
Position
11
AA seq 944 aa AA seqDB search
MTLQKSLGDAITTIWSVLDENDWNVKYVAIIYISYIVGLVSCYFLRKICSQSFVNFIKLL
KGVLVSIISVISLKYLNINTRVGINLLHIYNIVQVCSFLEVFSIRIKNTNKKLSNDQTSI
VNKYELDNENENVDYHTLIGDASEHLEKIAKTILNDKKSLEENKGILKEKELIEQIEQEE
KKEEEYMKAKNVSNSKKRNNGNKINLVWIYVFFSKTFNVIFFSLFWKLMPNLIIVKIFLT
LQLCANLIYTAKNIYKNNSNIKLLQKLIDGLNIAYYIFISLFFTKILYTFDENYNNNLIQ
NFAVISIVFHMYYGYVAFVKYIYDYYKQFRPSLFSFILFFHVFSIIGIIKLYHHEYRKSL
LIQCITFYLINGFGITFGAHRLWSHRAFKASTFVQVLFLILNSFANQGSVIIWAKNHRLH
HKYSDTKYDPHNIRNGFFYSHVGWLLYQKTKFVKEKEKEIYVDDLLQNPILMLQHKLDPY
FNFFFCFIIPGIYTYYMYNNFWDGFLILGALRWIITLHATWSINSASHSFGHRPYNADIK
ASNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYVIQLFYYLGLVWDLKSA
QNICKEVRLRESLKIEQRNKRLSENIKNQILKKEDTSYITDLMNSFKTFCNDYINISTFM
YILYFLRDITIMFTIFLIHIWYCYNKYGNGTAFSKLSLENNKLLNIIFFTFFHIILYGIP
MGTMFTSLYSLVYECKRGLIFKNQFLNNLFGSIISSFILLPYSSEKSRKSLLTSLNEDFF
KVLKGPIYFDLYIIIFSLVSILYGFIAYGFGYFYFCTFFLVPYIVFNAWLLLYVYLLKNP
PCLNAQIDAKDVDINILNYVAFQSLLEWKKNNSIYQSKKRLYKFVFSFINFMHHHLCYTY
VVEFINSKIPSYRTKEIYKYFDKTLDQYYFMRNDKFMEILKEFL
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacaaaagagtttgggggacgcaatcacaactatttggagtgtgttagacgaa
aatgattggaatgttaaatatgtagcaataatatatatatcgtatattgttggtttggtt
tcttgctattttttgagaaaaatatgttctcaatcttttgttaattttataaagctttta
aaaggtgttttagtttcaataatttctgtgattagcttgaaatatttaaacataaatacc
agagtaggtattaatttacttcatatatataatattgtgcaggtgtgtagttttttagaa
gtatttagcataagaattaaaaacacaaataaaaaattatcaaatgatcaaacttcaatc
gttaataaatatgagttagataatgaaaatgaaaatgtagactatcacacattaataggg
gatgcatcagaacatttagaaaaaatagcaaagaccattttgaatgacaaaaaatcctta
gaggaaaataaaggaatattaaaagaaaaggaacttatagaacaaattgaacaagaagaa
aaaaaagaagaagaatatatgaaagcaaaaaatgttagtaactccaaaaaaagaaataat
ggaaataaaataaatttggtttggatttatgtttttttttcaaaaacattcaatgtaata
tttttttctttattttggaagttaatgcccaatttgataatagtaaaaatatttttgaca
ttacaattatgtgcaaacttgatttatactgctaaaaatatttacaaaaacaattcaaat
ataaaattattacaaaaattaatagatggacttaatattgcatattatatttttataagt
ttattttttacaaaaatattatatacatttgatgaaaattataataataatttaatacaa
aacttcgcagttatttctattgtctttcatatgtattatggatacgtggcatttgttaaa
tatatttatgattattataagcaattcagaccatcgttattttcatttatattatttttt
catgtattttccataattggaataatcaaattatatcatcatgaataccgaaaatccttg
ttaatacagtgcataacattttacctcattaacggatttggaataacattcggtgcccat
cgattgtggtcacatagagcatttaaagctagtacattcgtgcaagttttatttctaatt
ttgaatagttttgcaaatcaaggtagtgtaataatatgggcaaagaatcaccgtttacat
cacaaatacagtgatacaaaatatgatcctcataatataagaaatggttttttttatagt
catgttggatggttattatatcaaaaaacaaaatttgttaaggaaaaagaaaaggaaatt
tatgttgacgatctattacaaaatccaattcttatgttacaacataaattagacccatat
ttcaacttttttttttgtttcataataccaggtatatatacctactatatgtataacaat
ttttgggatggatttttaattttaggtgctcttagatggattattaccttacatgctact
tggtcaattaatagtgcttctcattcatttggtcatagaccatataatgctgatataaaa
gcatctaataatatatttacatcaatagtagctcttggagagggatgtcataattatcat
cacgtatttccatattgttatgctatgaatgagaatttttatattcttagcataaaccca
acaaaatatgtaatacagcttttttattatttgggattagtatgggatttaaaatcagca
caaaatatatgtaaagaagtccgattaagagaatcattaaaaatagaacaaagaaataaa
aggctaagtgaaaatattaaaaatcaaatattgaaaaaagaagatacaagctatataaca
gatttaatgaattcctttaagacattttgtaacgattatataaatatttctacatttatg
tatatattatactttttaagagatattactattatgtttactattttcttaatacacata
tggtattgttataataaatatggaaatggaacagccttttcaaaattatcactagaaaat
aataaacttcttaatattattttttttacattttttcatataattctatatggcataccc
atgggaacgatgtttacaagtctctactcattagtttatgaatgcaaaagaggattaata
tttaaaaatcaattccttaacaatttatttggtagtataatatcatcttttattttatta
ccatattcctctgaaaaatcaagaaaatccttattaacatcattaaatgaagattttttt
aaagttttaaaaggaccaatatactttgatttatatataattattttttctttagtatca
atattatatggatttattgcttacggatttgggtacttttatttttgcacctttttctta
gtaccatatatagtttttaatgcatggttattactttatgtttatttgttaaagaatcca
ccatgcttaaatgcccagatagatgcaaaggatgtagatataaatattttaaattatgtt
gcctttcaatcattattagaatggaaaaaaaataattcaatttaccaaagcaagaaaaga
ttatataaatttgttttctcctttatcaattttatgcatcatcatttatgttatacatat
gttgtagaatttataaattcaaaaataccaagctaccgaacaaaggaaatctacaagtat
tttgacaaaactttagaccaatactattttatgcgtaatgacaaattcatggaaatatta
aaagaatttttataa

DBGET integrated database retrieval system