KEGG   Plasmodium yoelii: PY04895Help
Entry
PY04895           CDS       T01035                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pyo  Plasmodium yoelii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PY04895
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PY04895
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PY04895
Lipid biosynthesis proteins [BR:pyo01004]
 Desaturase
  First
   PY04895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 944 aa AA seqDB search
MTLQKSLGDAITTIWSVLDENDWNVKYVAIIYISYIVGLVSCYFLRKICSQSFVNFIKLL
KGVLVSIISVISLKYLNINTRVGINLLHIYNIVQVCSFLEVFSIRIKNTNKKLSNDQTSI
VNKYELDNENENVDYHTLIGDASEHLEKIAKTILNDKKSLEENKGILKEKELIEQIEQEE
KKEEEYMKAKNVSNSKKRNNGNKINLVWIYVFFSKTFNVIFFSLFWKLMPNLIIVKIFLT
LQLCANLIYTAKNIYKNNSNIKLLQKLIDGLNIAYYIFISLFFTKILYTFDENYNNNLIQ
NFAVISIVFHMYYGYVAFVKYIYDYYKQFRPSLFSFILFFHVFSIIGIIKLYHHEYRKSL
LIQCITFYLINGFGITFGAHRLWSHRAFKASTFVQVLFLILNSFANQGSVIIWAKNHRLH
HKYSDTKYDPHNIRNGFFYSHVGWLLYQKTKFVKEKEKEIYVDDLLQNPILMLQHKLDPY
FNFFFCFIIPGIYTYYMYNNFWDGFLILGALRWIITLHATWSINSASHSFGHRPYNADIK
ASNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYVIQLFYYLGLVWDLKSA
QNICKEVRLRESLKIEQRNKRLSENIKNQILKKEDTSYITDLMNSFKTFCNDYINISTFM
YILYFLRDITIMFTIFLIHIWYCYNKYGNGTAFSKLSLENNKLLNIIFFTFFHIILYGIP
MGTMFTSLYSLVYECKRGLIFKNQFLNNLFGSIISSFILLPYSSEKSRKSLLTSLNEDFF
KVLKGPIYFDLYIIIFSLVSILYGFIAYGFGYFYFCTFFLVPYIVFNAWLLLYVYLLKNP
PCLNAQIDAKDVDINILNYVAFQSLLEWKKNNSIYQSKKRLYKFVFSFINFMHHHLCYTY
VVEFINSKIPSYRTKEIYKYFDKTLDQYYFMRNDKFMEILKEFL
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacaaaagagtttgggggacgcaatcacaactatttggagtgtgttagacgaa
aatgattggaatgttaaatatgtagcaataatatatatatcgtatattgttggtttggtt
tcttgctattttttgagaaaaatatgttctcaatcttttgttaattttataaagctttta
aaaggtgttttagtttcaataatttctgtgattagcttgaaatatttaaacataaatacc
agagtaggtattaatttacttcatatatataatattgtgcaggtgtgtagttttttagaa
gtatttagcataagaattaaaaacacaaataaaaaattatcaaatgatcaaacttcaatc
gttaataaatatgagttagataatgaaaatgaaaatgtagactatcacacattaataggg
gatgcatcagaacatttagaaaaaatagcaaagaccattttgaatgacaaaaaatcctta
gaggaaaataaaggaatattaaaagaaaaggaacttatagaacaaattgaacaagaagaa
aaaaaagaagaagaatatatgaaagcaaaaaatgttagtaactccaaaaaaagaaataat
ggaaataaaataaatttggtttggatttatgtttttttttcaaaaacattcaatgtaata
tttttttctttattttggaagttaatgcccaatttgataatagtaaaaatatttttgaca
ttacaattatgtgcaaacttgatttatactgctaaaaatatttacaaaaacaattcaaat
ataaaattattacaaaaattaatagatggacttaatattgcatattatatttttataagt
ttattttttacaaaaatattatatacatttgatgaaaattataataataatttaatacaa
aacttcgcagttatttctattgtctttcatatgtattatggatacgtggcatttgttaaa
tatatttatgattattataagcaattcagaccatcgttattttcatttatattatttttt
catgtattttccataattggaataatcaaattatatcatcatgaataccgaaaatccttg
ttaatacagtgcataacattttacctcattaacggatttggaataacattcggtgcccat
cgattgtggtcacatagagcatttaaagctagtacattcgtgcaagttttatttctaatt
ttgaatagttttgcaaatcaaggtagtgtaataatatgggcaaagaatcaccgtttacat
cacaaatacagtgatacaaaatatgatcctcataatataagaaatggttttttttatagt
catgttggatggttattatatcaaaaaacaaaatttgttaaggaaaaagaaaaggaaatt
tatgttgacgatctattacaaaatccaattcttatgttacaacataaattagacccatat
ttcaacttttttttttgtttcataataccaggtatatatacctactatatgtataacaat
ttttgggatggatttttaattttaggtgctcttagatggattattaccttacatgctact
tggtcaattaatagtgcttctcattcatttggtcatagaccatataatgctgatataaaa
gcatctaataatatatttacatcaatagtagctcttggagagggatgtcataattatcat
cacgtatttccatattgttatgctatgaatgagaatttttatattcttagcataaaccca
acaaaatatgtaatacagcttttttattatttgggattagtatgggatttaaaatcagca
caaaatatatgtaaagaagtccgattaagagaatcattaaaaatagaacaaagaaataaa
aggctaagtgaaaatattaaaaatcaaatattgaaaaaagaagatacaagctatataaca
gatttaatgaattcctttaagacattttgtaacgattatataaatatttctacatttatg
tatatattatactttttaagagatattactattatgtttactattttcttaatacacata
tggtattgttataataaatatggaaatggaacagccttttcaaaattatcactagaaaat
aataaacttcttaatattattttttttacattttttcatataattctatatggcataccc
atgggaacgatgtttacaagtctctactcattagtttatgaatgcaaaagaggattaata
tttaaaaatcaattccttaacaatttatttggtagtataatatcatcttttattttatta
ccatattcctctgaaaaatcaagaaaatccttattaacatcattaaatgaagattttttt
aaagttttaaaaggaccaatatactttgatttatatataattattttttctttagtatca
atattatatggatttattgcttacggatttgggtacttttatttttgcacctttttctta
gtaccatatatagtttttaatgcatggttattactttatgtttatttgttaaagaatcca
ccatgcttaaatgcccagatagatgcaaaggatgtagatataaatattttaaattatgtt
gcctttcaatcattattagaatggaaaaaaaataattcaatttaccaaagcaagaaaaga
ttatataaatttgttttctcctttatcaattttatgcatcatcatttatgttatacatat
gttgtagaatttataaattcaaaaataccaagctaccgaacaaaggaaatctacaagtat
tttgacaaaactttagaccaatactattttatgcgtaatgacaaattcatggaaatatta
aaagaatttttataa

DBGET integrated database retrieval system