KEGG   Plasmodium yoelii: PY05016Help
Entry
PY05016           CDS       T01035                                 

Definition
protein-l-isoaspartate o-methyltransferase-related
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PY05016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MYALVENNHIDLINNLKRRGIIDDDEVYDTMLQVDRGRYIKENPYVDTPIYISHGVTISS
PHMHALSLKRLMNVLKPGSRAIDVEQIEKKIAKTETNAMSHLWTTPFTILVSSGSGYLTV
CMAIRTNVLKNKNSFVIGIERVKELVDFSIGNIKKDKPELLNIENFKIIHKNIYQVNEEE
QKELGFFDAIHVGASASELPDILIKLLAENGKLIIPLEEGPTQVLYEITKKNGKIIKDRL
FEVCFVTLKKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctctagtagaaaataaccatatcgatttaattaataatttaaaaagaagagga
ataattgatgatgatgaagtatatgatactatgttacaggtagatcgaggtagatatata
aaagaaaatccatatgtcgatactcctatttacattagtcatggtgtaactatatcatct
ccacacatgcatgctttatccttaaaacggcttatgaatgtgttaaaaccgggttcaagg
gcaattgatgttgaacaaattgagaaaaaaattgcgaaaacagagacaaatgcgatgtca
catttgtggacaacaccatttaccattctcgtgagttcggggtcaggatatcttacagta
tgtatggcaatacgaacaaacgttttaaaaaataaaaattcttttgttattggaatagaa
agagtaaaagagttagtagatttttcaattggaaatataaaaaaagataaaccagaatta
ttaaatatagaaaattttaaaattatacataaaaatatatatcaagtaaatgaagaagaa
caaaaagaattaggtttttttgatgcgattcatgttggtgcatctgctagtgaacttcct
gatatattaataaaattattagcagaaaatggaaaacttataatacctttagaagaaggt
ccaacacaagttttatatgaaattacaaaaaaaaatggaaaaatcattaaagatcgatta
tttgaagtttgtttcgttactttaaaaaaaaattaa

DBGET integrated database retrieval system