KEGG   Plasmodium yoelii: PY05019Help
Entry
PY05019           CDS       T01035                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pyo  Plasmodium yoelii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PY05019
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PY05019
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PY05019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MYECIQNYLTKHIDEQNIYVKKCVSIIGSPLAAGQSLGGVNKACDNLRQLGLYDVIKAMG
WKYNDIGNIGESISINTFLNSANAEKGIKKEAEKEAEKGAKKEAEKEAEKGAKINGNESN
YYSNIKNAQVIGKFSEQLFQIMSSEIKKKNFILNIGGDHGVAFSSILATLQTYKNLKVIW
IDAHGDINIPETSPSGNYHGMSLAHVLGLFKKKVPHFEWSENLLHLKPENVAIIGIRDID
KYEKIILKNCNINYYTMFDIDKKGIYNIICEALNKIDPDQNSPIHISLDIDSVDSIYAPG
TGTIAKGGLNYREINLLMKSISDTKRVVSMDIVEYNPLLDENDKAVHGDSLPIDPNATKT
GKLCLELIARVLGNDIV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatgtatccaaaactacttaacaaaacatatagatgaacaaaatatttatgtt
aaaaaatgtgtttcaattattgggtctccattagctgctggccaatctcttggaggtgta
aataaagcatgtgacaatttgaggcaactcggattatatgatgttattaaagctatgggt
tggaaatataacgatattggaaatattggggaaagtatatcgatcaatacttttctaaat
tcagcaaatgccgaaaagggaatcaaaaaggaggctgaaaaggaggctgaaaagggagcc
aaaaaggaggctgaaaaggaggctgaaaagggagccaaaataaatggcaatgaatcaaac
tactatagcaatataaaaaacgcacaagtgattggcaaatttagtgaacaattatttcaa
atcatgagttcagaaataaaaaaaaaaaattttattttaaatattgggggagatcatgga
gtagctttttcaagcatactagccacactacaaacatataaaaatttaaaagtgatatgg
atagatgcacatggagatataaatataccagaaacatctccttctggaaattatcatgga
atgtcattagcacatgtattaggattgtttaaaaaaaaagttccacattttgaatggtca
gaaaatttgttacatttaaaaccagaaaatgtagctattattggaataagagatattgat
aaatatgaaaaaatcattttaaaaaattgtaatataaattattatactatgtttgatata
gataaaaaaggtatatacaacattatttgtgaagctttaaataaaattgatccagatcaa
aattctcctatacatatatcattagatattgatagtgtcgattcaatatatgctcctgga
actggaacaatagctaaaggtggtttaaattatagagaaataaatttattaatgaaatcg
atatcagatacaaaacgagttgtatctatggatattgttgaatataacccacttttggat
gaaaatgataaagcagttcatggagattcgctaccaattgatcccaatgctactaaaact
ggaaaattatgtcttgagcttattgccagagtcctaggcaatgatatcgtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system