KEGG   Plasmodium yoelii: PY17X_0827400Help
Entry
PY17X_0827400     CDS       T01035                                 

Gene name
PY05179
Definition
(RefSeq) uncharacterized protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PY17X_0827400 (PY05179)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_1 FAD_binding_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 3790940
NCBI-ProteinID: XP_725601
Position
8
AA seq 749 aa AA seqDB search
MNSDWKTILSYSIFFTGNIYFLWKIQNAYSFKSIVACIRKCLNYSKKKKFANNAIAQNVK
IYFGSQSGTGEQFAKELCYNLQEIFDIKADIVDLEYFNKEEIKTFGIRIFIVSTYGNGDP
PDNAIEFFKWLKELDINNTYFRNTKYSIMGLGSKQYSHFNKIAKKLTTYLKNFKAEQISE
TIYGDDDDNIYHDFEIWKNKFFKELSKILNMNHIPINFIKEEVIKLVDWKNLPDIKFDLK
FEDIEEDDKKSETKHHTTNLLKDNDNSKEAQFNKHISTSLTGKFYFNHNIGTVISNTNLL
KNVDDSTNSDKVNHIIISAKNIKYKSADTLVVLTKNSKQTTDWWLKRLNINETDKNKKFT
FVERNGQNSPKYDNTPYLNGTNDEKNDILINKNSNENNGNNGNNNSMHIPFPTPCTIEEA
LQCYCDLSTIPRVNVLKNFKCFIKDIEELKMFNYILSNNKRNTFFNICKEFEMTFIEFVD
IFMQSAIFELTPFLQLIPKIAPKSYTISSSPKDDPDIITLTVKKKQYPIHSLRKALKSFK
NNNMLPNITEQKLRNLCERRWYKGSSSYYLTEELYPNDIIKFNVKTSIFTLPENLGDASI
IMIATGTGIAPFKAFLTEFKLFDQKREKNEILNKKSQRILFYGCRKKGIDFLYEKEIMDS
LENKYIDEVYLAFSRDQSNKIYVQDLIREQKERVCNLIQNGAYVYICGNTEMGKDVKQTI
INLYENNKQNDKKIIKKLKKSGRFFEETW
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgattggaaaacgattttatcatactctatattttttacaggtaacatatac
tttctttggaaaattcaaaatgcatattcttttaaaagtatagtagcctgtataagaaaa
tgtttaaattatagtaaaaaaaaaaaatttgcaaataatgcaattgctcaaaatgtaaaa
atatattttggtagccaaagtggaacaggggaacagtttgcaaaagagttgtgttacaat
ttacaggaaatatttgatataaaagcggatattgttgatttagaatactttaataaagaa
gaaataaaaacatttggcattcgtatattcattgtttcaacatatggaaatggtgaccca
ccagataatgccatcgaattctttaaatggctaaaagaactagatataaataacacatat
tttaggaatacaaaatattctataatgggtttaggaagtaaacaatatagccattttaac
aaaatagccaaaaaacttacaacttatcttaaaaattttaaagcagaacaaattagtgaa
actatatatggtgatgatgatgataatatttatcatgattttgaaatatggaaaaataaa
ttttttaaagaattatcgaaaattttaaatatgaaccatattccaattaattttatcaaa
gaagaagttattaaattagtggattggaaaaatcttcctgacatcaaattcgatttaaaa
tttgaagatatcgaagaagatgataagaaaagcgaaacgaaacaccatactactaatttg
ttaaaagataatgataattctaaagaagctcaatttaataagcatatatccacaagtctt
actggaaaattttattttaaccacaatattggtactgtaatatctaacacaaatttgtta
aaaaatgtagatgattctactaattctgataaagttaatcatataattatatcggcaaaa
aatattaaatacaagtctgctgatactttagttgttttaacaaaaaattcaaaacaaacc
acagattggtggttaaaacgattaaatataaatgaaactgacaaaaataaaaaatttacc
tttgtggaacgaaatggtcaaaattcaccaaaatatgataataccccatatttaaatggt
actaatgatgagaaaaatgacatattaataaataaaaatagtaatgaaaataatggcaat
aatggcaataacaattccatgcatattccgtttccaacaccatgtacaattgaagaagcc
ttacaatgttattgcgatttatcaactatacctcgagtaaatgttttaaagaattttaaa
tgttttattaaagacatagaagaacttaaaatgtttaactatattttatcaaataataaa
aggaatacattttttaatatatgcaaagaatttgaaatgacatttattgaatttgtagat
atattcatgcaaagtgccatatttgaattgacgccatttttacaattaattccaaaaatt
gcgcccaaaagctatacaatatcttcttctccaaaagatgatccagacattattacactg
actgtaaaaaaaaaacaatatcctattcattctcttaggaaagcattaaaaagttttaaa
aataataatatgttaccaaatattactgaacaaaaattacgaaatttgtgtgaaagaaga
tggtataaaggctcatcttcttattatttaacagaagaattatatccaaatgatataatc
aaatttaatgttaaaacatcaatatttacacttcccgaaaatttaggagacgccagcatt
ataatgattgctaccggaacaggaatagctccttttaaagcttttcttacagaatttaaa
ctttttgaccaaaaacgtgaaaaaaatgaaatattaaataaaaaatcccaaagaatatta
ttctatggttgcagaaaaaaaggaatagattttttatatgaaaaagaaattatggactct
ttggaaaacaaatatattgatgaagtttatttagcattttcaagggaccaaagcaataaa
atttatgtacaagatttaattcgtgaacaaaaggaacgtgtgtgtaacttgatacaaaac
ggtgcatacgtatacatatgtggaaataccgaaatgggtaaggatgtgaaacaaacaatt
attaatttatatgaaaataataagcaaaatgataaaaagattataaaaaaattaaagaaa
tcaggacgattttttgaggaaacatggtaa

DBGET integrated database retrieval system