KEGG   Plasmodium yoelii: PY05235Help
Entry
PY05235           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pyo  Plasmodium yoelii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MIQFLKNLQLYKKRETSDIKPNTKKSKMKYEDFNFIRTLGTGSFGRVILATYKNEDLPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYINHPFCVKLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYEILVGYPPFYANEPLLIYQK
ILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQSVKEHPWFANIEWNNLLNKK
VDVPYKPKYKNIFDASNFEKVQEDLSIADKVINENDPFFDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttaaaaatctacagttatataaaaagagggaaacttccgatataaaa
cccaatacaaaaaaaagtaaaatgaaatatgaggactttaattttattcgtacgcttgga
actgggtcatttgggagagtaattttagcaacatataaaaatgaagacttgccaccagtt
gcaataaaacgatttgaaaaaagtaaaataataaaacaaaaacaagttgatcatgtattt
tctgaaagaaaaatattaaattatataaatcatccattttgtgttaaattatatgggtcg
tttaaggatgaatcttatttatatttggttcttgaatttgtaattggaggtgaatttttt
acatttttgagacgaaataaaagattcccaaatgatgtgggatgcttttatgcagcacaa
attgttttgatattcgaatatttgcagagtttaaacattgtatacagagacttaaagcct
gagaatttacttctggataaagatggattcataaaaatgactgattttggttttgcaaaa
gttgtaaatacgagaacttacacattatgtgggacacctgaatatatagcccccgaaata
ttgctaaatgctgggcatggaaaagcggtggattggtggacattgggaatcttcatttac
gaaattttagttggataccctcctttttatgcaaatgaacctttattaatatatcagaag
attttagaaggaataatttatttccctaaatttttagataataattgtaagcacttaatg
aaaaaattactatcccatgatcttacaaaaagatatggaaatttaaaaaaaggagctcaa
agtgttaaagagcatccatggtttgccaatatagaatggaacaatttattgaacaaaaaa
gttgatgtcccatataagcctaaatataaaaatatatttgatgcatctaattttgaaaag
gttcaagaagatttatctatagcagataaagttattaatgaaaatgatccgttttttgat
tggtaa

DBGET integrated database retrieval system