KEGG   Plasmodium yoelii: PY05235Help
Entry
PY05235           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PY05235
Protein kinases [BR:pyo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PY05235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MIQFLKNLQLYKKRETSDIKPNTKKSKMKYEDFNFIRTLGTGSFGRVILATYKNEDLPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYINHPFCVKLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYEILVGYPPFYANEPLLIYQK
ILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQSVKEHPWFANIEWNNLLNKK
VDVPYKPKYKNIFDASNFEKVQEDLSIADKVINENDPFFDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttaaaaatctacagttatataaaaagagggaaacttccgatataaaa
cccaatacaaaaaaaagtaaaatgaaatatgaggactttaattttattcgtacgcttgga
actgggtcatttgggagagtaattttagcaacatataaaaatgaagacttgccaccagtt
gcaataaaacgatttgaaaaaagtaaaataataaaacaaaaacaagttgatcatgtattt
tctgaaagaaaaatattaaattatataaatcatccattttgtgttaaattatatgggtcg
tttaaggatgaatcttatttatatttggttcttgaatttgtaattggaggtgaatttttt
acatttttgagacgaaataaaagattcccaaatgatgtgggatgcttttatgcagcacaa
attgttttgatattcgaatatttgcagagtttaaacattgtatacagagacttaaagcct
gagaatttacttctggataaagatggattcataaaaatgactgattttggttttgcaaaa
gttgtaaatacgagaacttacacattatgtgggacacctgaatatatagcccccgaaata
ttgctaaatgctgggcatggaaaagcggtggattggtggacattgggaatcttcatttac
gaaattttagttggataccctcctttttatgcaaatgaacctttattaatatatcagaag
attttagaaggaataatttatttccctaaatttttagataataattgtaagcacttaatg
aaaaaattactatcccatgatcttacaaaaagatatggaaatttaaaaaaaggagctcaa
agtgttaaagagcatccatggtttgccaatatagaatggaacaatttattgaacaaaaaa
gttgatgtcccatataagcctaaatataaaaatatatttgatgcatctaattttgaaaag
gttcaagaagatttatctatagcagataaagttattaatgaaaatgatccgttttttgat
tggtaa

DBGET integrated database retrieval system