KEGG   Plasmodium yoelii: PY17X_0839000Help
Entry
PY17X_0839000     CDS       T01035                                 

Gene name
PY05235
Definition
(RefSeq) uncharacterized protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PY17X_0839000 (PY05235)
Protein kinases [BR:pyo01001]
 Serine/threonine kinases: AGC group
  PKA family
   PY17X_0839000 (PY05235)
Messenger RNA biogenesis [BR:pyo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PY17X_0839000 (PY05235)
Chromosome and associated proteins [BR:pyo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PY17X_0839000 (PY05235)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 3791008
NCBI-ProteinID: XP_725669
UniProt: Q26217
Position
8
AA seq 341 aa AA seqDB search
MIQFLKNLQLYKKRETSDIKPNTKKSKMKYEDFNFIRTLGTGSFGRVILATYKNEDLPPV
AIKRFEKSKIIKQKQVDHVFSERKILNYINHPFCVKLYGSFKDESYLYLVLEFVIGGEFF
TFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPENLLLDKDGFIKMTDFGFAK
VVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYEILVGYPPFYANEPLLIYQK
ILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQSVKEHPWFANIEWNNLLNKK
VDVPYKPKYKNIFDASNFEKVQEDLSIADKVINENDPFFDW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttcttaaaaatctacagttatataaaaagagggaaacttccgatataaaa
cccaatacaaaaaaaagtaaaatgaaatatgaggactttaattttattcgtacgcttgga
actgggtcatttgggagagtaattttagcaacatataaaaatgaagacttgccaccagtt
gcaataaaacgatttgaaaaaagtaaaataataaaacaaaaacaagttgatcatgtattt
tctgaaagaaaaatattaaattatataaatcatccattttgtgttaaattatatgggtcg
tttaaggatgaatcttatttatatttggttcttgaatttgtaattggaggtgaatttttt
acatttttgagacgaaataaaagattcccaaatgatgtgggatgcttttatgcagcacaa
attgttttgatattcgaatatttgcagagtttaaacattgtatacagagacttaaagcct
gagaatttacttctggataaagatggattcataaaaatgactgattttggttttgcaaaa
gttgtaaatacgagaacttacacattatgtgggacacctgaatatatagcccccgaaata
ttgctaaatgctgggcatggaaaagcggtggattggtggacattgggaatcttcatttac
gaaattttagttggataccctcctttttatgcaaatgaacctttattaatatatcagaag
attttagaaggaataatttatttccctaaatttttagataataattgtaagcacttaatg
aaaaaattactatcccatgatcttacaaaaagatatggaaatttaaaaaaaggagctcaa
agtgttaaagagcatccatggtttgccaatatagaatggaacaatttattgaacaaaaaa
gttgatgtcccatataagcctaaatataaaaatatatttgatgcatctaattttgaaaag
gttcaagaagatttatctatagcagataaagttattaatgaaaatgatccgttttttgat
tggtaa

DBGET integrated database retrieval system