KEGG   Plasmodium yoelii: PY17X_0823600Help
Entry
PY17X_0823600     CDS       T01035                                 

Gene name
PY05335
Definition
(RefSeq) protein disulfide isomerase, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8
AA seq 508 aa AA seqDB search
MGNYTFIYFFFIIVFFFTPELFKCSIWEGVSDDFAKKVNHLTHEMELQIYSQHTQYCVAL
FCNHNEIKCKDVYKEFVSAANAIDKGDVVFVYIDTVKLAKTADNFEIKNVPKILIFRDYD
PEKGYTFHKKYTKENIIEWLNTLPMPSVEVMDLGDVNKYVEINKKKGFASIIAYCTKGSK
NCDKFVHFGETNKIPNLAIGLTYIDNNEEPRVEILNGPGSTIPNDSIKYKDIYKPTNNIW
TSDSIWNFTNSYMNQFPIIINYTRKLMHPIKDEIYLYLYNEFGEYSDSTYVEVYGVIQKY
NKIKFVFPRKEEFSEMFALEETNKYICIMDYTDANIDSAYVLLRPRKFVQKVENIKSEIV
ENFIENFYNNKLTQFRKSEKEVKRLHKQNYQILCSNNFESYVLDPNKLVLVFYHLHGCKE
CKPLFSFWEKVSNYFHLEYPKEDILVAAMDAKLNDMIDTSIKIYPSIGIYPKGVDKIKRR
THIMFPTKLETLIDVTEEILEGEENSDL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactatacttttatatatttttttttcataattgttttttttttcacccctgaa
ctttttaaatgttcaatatgggagggtgtaagtgatgattttgcaaaaaaagtaaatcat
ttaacccatgagatggaattacaaatatatagtcagcatacacaatattgtgttgcatta
ttttgtaatcataatgaaataaaatgtaaagatgtatataaagaatttgttagcgctgca
aatgcaatcgataaaggggatgtggtttttgtttatatcgatactgtaaaattagcaaaa
actgctgataattttgaaattaaaaatgtgcctaaaatattaatttttcgagattatgat
cctgaaaaaggatatacatttcataaaaaatatacaaaagaaaatataattgaatggtta
aatacacttcctatgccatcagtagaggttatggatcttggagatgtcaataaatatgta
gaaattaacaagaaaaagggatttgcatctattattgcatattgtactaaaggatcaaaa
aattgtgataaatttgttcattttggtgaaacaaataaaataccaaatttagcaatcggg
ctaacatatatagataataatgaagaacctcgagttgaaattttaaatggaccaggttct
acaataccaaatgattctattaaatataaagatatttataaacctacaaataatatatgg
acatctgattctatttggaattttactaatagttacatgaatcaatttcctattatcatt
aattatactagaaaattaatgcatccaataaaagatgaaatatatctttatctttacaac
gaatttggtgaatattcagatagtacttatgttgaagtttatggagttattcaaaagtat
aacaagataaaatttgtcttcccaaggaaagaagaattcagtgaaatgtttgcacttgaa
gaaacaaacaaatatatttgtataatggattatactgatgcaaatattgatagtgcttat
gtattattaaggcctcgtaaatttgtacaaaaagttgaaaatataaaatcagaaatagta
gaaaattttatcgaaaatttttataataataaacttactcaatttcgaaaatctgaaaaa
gaagttaaaagattacataaacaaaattatcaaatattatgttcaaataattttgaatct
tatgttttagatccaaataaattagttttagtattttatcatcttcatggttgtaaagaa
tgtaaacctttgttctctttttgggaaaaagtttctaattattttcatttagaatatcca
aaagaagatattttagttgcagctatggatgcaaaattaaatgacatgattgacacatct
attaagatataccctagtattggaatttatccaaaaggagtagacaaaataaagagaaga
acacacatcatgtttcccaccaaattagaaacattaattgatgtgactgaagaaatatta
gaaggagaagaaaattctgatttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system