KEGG   Plasmodium yoelii: PY17X_1335300Help
Entry
PY17X_1335300     CDS       T01035                                 

Gene name
PY05578
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00900  Terpenoid backbone biosynthesis
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PY17X_1335300 (PY05578)
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PY17X_1335300 (PY05578)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C TcdB_N Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 3791391
NCBI-ProteinID: XP_726051
UniProt: A0A078KKN6
Position
13
AA seq 493 aa AA seqDB search
MRTLINLRTLPLLFFILILFLHNSKGVHKKKAYIINYNRSSNGKIKTIAKNNKKGRVKSR
RKWRVKYAIENDLTSVISQNKPINVGIFGSTGSIGTNTLSIIRECNKIEKKFNVEALYVN
KNVEGIYEQAKEFLPKYVCIHDPSKYEELKKLLENIKNYNPIILIGNEGMKQICSSNEID
KIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDSEHN
AIFQCLNNNILLKSKCLQENYSKINQINKIFLCSSGGPFQNLSIDELKNVSSEKALKHPK
WNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIVHKECIMHSCVEFLDKSVISQM
YYPDMRVQIIYALTWPNRINTNLKSLNFEEISPLTFYKPSLKHFPCINLAYHAGRKSNFF
PTVLNASNEVVNNLFLNNKIKYFDIPAIISQVLESFNPQQISENPEDLMKQILEIHNWSK
QKAVDIYNTKITS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcttattaatttgcgtactcttcctctattgttttttatattgatcctgttt
ttacacaatagtaagggtgtacataaaaaaaaagcgtatatcataaattataatagaagc
tcaaatgggaaaataaaaacaatcgctaagaataataaaaagggtcgagtaaaaagtaga
agaaaatggagagtaaaatatgcaattgaaaatgatctaactagtgttatttcacaaaac
aaaccaataaatgttggtatttttgggagtacaggtagtataggaactaatacccttagc
atcatacgagaatgtaataaaatagaaaaaaaatttaatgttgaagctttatatgttaat
aaaaatgttgaaggaatatatgagcaagctaaagaatttttaccgaaatatgtgtgtata
catgatccaagtaaatatgaagaattaaaaaaattattagaaaatataaaaaactataat
ccaataatattgattggtaatgaaggtatgaaacaaatatgtagtagtaatgaaatagat
aaaatagttatcggtattgattcatttcaaggtttatattcaacaatatatgcaataaaa
aataataaaactattgcattagcaaataaggaatctattgtatcagctggatttttctta
aaaaaattattaactgttcataaaaattcaacaataatacctgtagattctgaacataat
gcaatattccaatgtttaaataataatatattattaaagtcaaaatgcttacaagaaaat
tattctaaaataaatcaaataaataaaatatttttatgttcatctggtggaccatttcaa
aatttatcaatagatgaactaaaaaatgtatcatctgaaaaagcattaaaacatccaaaa
tggaatatgggaaaaaaaatatcaatagattcagcaacaatgatgaataaaggattagaa
gtaattgaagcacattttctttttgatattgattataatgatattgaaataattgtacat
aaagaatgtataatgcattcatgtgtagaatttttagacaaatctgttatatcacaaatg
tattacccagatatgagagtacaaattatatatgcattaacatggcctaatagaataaac
acaaatttaaagtctctaaattttgaagaaatatcacctctcactttttataagccatct
ttaaaacatttcccatgtataaatttagcttatcatgctggacgaaaatcgaattttttt
ccaaccgttcttaatgcatctaatgaggttgttaataatctttttctaaataataaaatt
aaatattttgatataccagctattatatctcaagttttagaatcatttaatcctcaacaa
atttctgaaaatccagaggatcttatgaaacaaattttggagatacataattggtccaag
caaaaagccgtggatatatataataccaaaataacttcttaa

DBGET integrated database retrieval system