KEGG   Plasmodium yoelii: PY05993Help
Entry
PY05993           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K14566  
U3 small nucleolar RNA-associated protein 24
Organism
pyo  Plasmodium yoelii
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:pyo03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 216 aa AA seqDB search
MTIIYSIVCSMHIYSCIFFFCPFQGKFKKTQKVLKLKRVINPNDNRLKKTNDKVIKKNDK
KNEGKVKQIVPIDSNLFFNYNENLCPPYNIILDTNFINSSIQYKIDIIKGCSELLLAKCN
IYVTDCVVAEMEKLGQRYSLALKLLKDPRYNRLTCTHKGTYADDCIVNRVTESRCYIIAT
NDRDLKIRLRKIPGVPILYAKNFKYKIERLPDNIMI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactattatttatagtatagtttgttctatgcatatatattcttgtattttttttttt
tgtccatttcaggggaagtttaaaaaaacacaaaaagttttaaaactaaaaagggtgata
aacccaaatgataatagattaaaaaaaacgaatgataaagtaataaaaaaaaatgataaa
aaaaatgaaggaaaagttaaacaaatagttccaattgatagtaatttattttttaattat
aatgaaaatttatgtccaccatataatataatattagatacaaattttataaattcaagt
atacaatataaaattgatataattaaaggatgttcagaattattattagcaaaatgtaat
atttatgtaacggattgtgttgttgcagaaatggaaaagttaggacaacgatattcgctt
gctttaaaattactaaaagatccgagatataatagattaacatgcacacacaaaggaaca
tatgctgatgattgtatagtcaatcgagttactgaaagtcggtgctatataattgcaaca
aatgatagagacttaaaaatacgtttaagaaaaattccaggggttccaatcttatatgca
aaaaatttcaaatataaaattgaaagacttccagacaatattatgatataa

DBGET integrated database retrieval system