KEGG   Plasmodium yoelii: PY17X_1460000Help
Entry
PY17X_1460000     CDS       T01035                                 

Gene name
PY06009
Definition
(RefSeq) uncharacterized protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
pyo  Plasmodium yoelii
Pathway
pyo03022  Basal transcription factors
pyo03420  Nucleotide excision repair
Module
pyo_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PY17X_1460000 (PY06009)
  Replication and repair
   03420 Nucleotide excision repair
    PY17X_1460000 (PY06009)
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PY17X_1460000 (PY06009)
DNA repair and recombination proteins [BR:pyo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     PY17X_1460000 (PY06009)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 3791920
NCBI-ProteinID: XP_726580
UniProt: A0A077YCP3
Position
14
AA seq 926 aa AA seqDB search
MVKARKNIENMEIYDYMKEMDEKVWEYLFDDSLAHETIFSSLNELEQIIISRLLFIQQVV
SERAMRLWINPNFLKKLSESIKNLVDVKILVESETKKDNYNQYKINDRFRLTLLNKIYQN
DKNNIFIFNNNIKLQLNKEKELYEKKLFPTKEGILCYANTRWNTLLHFIASPNLNSYKYT
HSYSGSYASTYPHSSSIHGGIESPIKTEVGGSLDVNNIHSYGGEYSYNNSLKSVKMEKGN
YYGIQTKKGKKNNEDSDEEYQPYGDEMYDDENYGNESFPQRRKYKNYGEYENMGNDSEYD
EDEDNEDETNEQYDNSLYPQDKETRNKYSQNYNDIENSNSSKYLNARMGNKENVNLYDPN
KKRDGRRGRKKKKGVYAYKQNNLYYKSLQSRENNNMEEENNDFFFSSSNIKKEDLLTCAP
CGSLIEVLKKKKFILDDINNSSNIANNNSNNKTINMSREAFSWFLKDIRSRIISLVIEYL
LIIDDGNVTNIAKQNSAKHKKKNNSENVTSSEGNEALANSSITNTLINDFNNNDNNNNNM
NGGEWGTNNEDMNNADGVNIKDTQDYITDPNKNSQKSEIYVKETLLLILSLTQCNIGQPI
FLENLTKAQKEFVDFGIHIGLFLKTHDSYIFITPYALLLTINNLNVENYISILNHLSVEK
FCEESGYNNNDDENIKKKAKLSEIYFHKYLLLQNTVRVKSEPLMDEDEKKNLKKIETKNL
ISQDITNHNIHSEKRLNENDNLEIGLIIQSNFKVYLYTSSILKINILSHLCELQARTPNM
VVGILTRRSVLNAYNSDITADQIIKFLESYSHPGKTKLKSIIPINVITQLKLWEAERHRL
TLEDSIVFKNFEKEYLPHLYQQIVIWANSKNYLLHYTPWPKNTNSTEFDAWMKAEKYLCC
IYESKNEIIDKIKEIRGKLMKKRQAI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcacgaaaaaatattgagaatatggaaatatatgattacatgaaggagatg
gatgaaaaagtatgggaatatttgtttgatgattcactagcacatgaaactatatttagc
tcactaaatgaattagagcaaattataatatctagactattgtttattcaacaagtagtt
tcagaaagagctatgagattatggataaatccaaactttttgaaaaaattaagtgaaagt
ataaaaaatttagttgatgttaaaatattagtagaaagtgaaacaaaaaaagataactat
aatcaatataaaataaatgatcgattcagattaacattattaaataaaatatatcaaaat
gataaaaataatatttttatatttaataataatataaaactacaattaaataaagaaaaa
gaattatatgaaaaaaaattatttcctacaaaagaaggtattctatgttatgctaataca
cgatggaatactctcttacattttattgcttcaccaaatttgaatagttataaatatacc
catagttatagtggtagttatgctagtacatacccacatagtagcagtattcatggtggt
atagaatctcctattaaaactgaagtgggtggatcactcgatgtaaataatattcactct
tatggaggagagtattcttataataacagtttgaaaagtgtaaaaatggaaaaaggaaac
tattatggtattcaaactaaaaaaggcaaaaaaaataatgaagatagtgatgaagaatat
caaccttatggtgatgaaatgtatgatgacgaaaattatggaaacgaatcatttccacaa
agaaggaaatataaaaattatggagaatatgaaaacatgggaaatgattcagaatatgat
gaagatgaagataatgaagatgaaacaaatgaacaatatgacaattcattatacccacaa
gataaagaaacccgaaataaatattcacagaattataatgacattgaaaatagtaatagt
agtaaatatttaaacgcaagaatgggtaataaagaaaatgtaaatttatatgatccaaat
aaaaaaagagatggaagacgaggaagaaaaaaaaaaaaaggagtatatgcatataaacaa
aataatttatattataaaagtcttcaaagtagagaaaataataatatggaagaagaaaat
aatgatttttttttttcttcatcaaatattaaaaaagaagatttgttaacatgtgcaccg
tgtggtagtttgatagaagttttgaaaaaaaaaaaatttatacttgatgatataaataat
agttctaatattgctaataataatagtaataataaaacgataaatatgagtagagaagca
ttttcatggtttttaaaagatatacgaagtagaataatatctctagttattgaatatttg
ctgataattgatgatggaaatgtaacaaatatagctaagcaaaattcagctaaacataaa
aaaaaaaacaattcagaaaatgtgacttctagtgaaggaaatgaagctttagcaaatagt
tccatcacaaatactcttataaatgattttaacaataatgataataataataataatatg
aacggaggggaatggggtactaacaatgaagatatgaataatgcagatggtgtaaatata
aaagatacacaagattatataacagatccaaataaaaattctcaaaaatctgagatatat
gtaaaagaaacattattattaattttatcactaactcaatgtaatattggtcaaccaata
tttttagaaaacttaacaaaagctcaaaaagaatttgtagattttggtatacatataggg
ttatttttaaaaacacatgatagttatatatttataacaccatatgcattattattaaca
ataaataatttaaatgttgaaaattatatatctatattaaatcatttatctgtagaaaaa
ttttgtgaagaatctggttataataataatgatgatgaaaatataaaaaaaaaagcaaaa
ttaagtgaaatatattttcataaatatttattattacaaaatacggttcgtgtgaaaagt
gaaccactaatggatgaggacgagaaaaaaaatttgaaaaaaattgaaacaaaaaatttg
atttcgcaagacataactaatcacaatatacattcagaaaaaaggttaaatgaaaatgat
aatttagaaatagggttaatcattcaaagtaattttaaagtttatttgtatacttcgtct
attttaaaaataaatattttaagccacttatgtgaattacaagcaagaacaccaaatatg
gttgttggtatattaacaagaagaagtgtattaaatgcatataattcagatattaccgct
gatcaaattattaaatttttagaatcttattcacatcctggaaaaactaaattaaaaagt
ataataccaattaatgttattactcagcttaaattatgggaagctgaaagacatcgatta
acattagaagattctattgtttttaaaaatttcgaaaaagaatatttaccacatttatat
caacaaattgttatttgggctaatagcaaaaattatttattacattatactccatggcca
aaaaatactaattccactgaatttgatgcatggatgaaagcagaaaaatatctatgttgt
atatatgagtcgaaaaatgaaattattgataagataaaggaaattcgtggtaagttaatg
aaaaaacgtcaggcaatatga

DBGET integrated database retrieval system