KEGG   Plasmodium yoelii: PY06009Help
Entry
PY06009           CDS       T01035                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pyo  Plasmodium yoelii
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PY06009
  Replication and repair
   03420 Nucleotide excision repair
    PY06009
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PY06009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 926 aa AA seqDB search
MVKARKNIENMEIYDYMKEMDEKVWEYLFDDSLAHETIFSSLNELEQIIISRLLFIQQVV
SERAMRLWINPNFLKKLSESIKNLVDVKILVESETKKDNYNQYKINDRFRLTLLNKIYQN
DKNNIFIFNNNIKLQLNKEKELYEKKLFPTKEGILCYANTRWNTLLHFIASPNLNSYKYT
HSYSGSYASTYPHSSSIHGGIESPIKTEVGGSLDVNNIHSYGGEYSYNNSLKSVKMEKGN
YYGIQTKKGKKNNEDSDEEYQPYGDEMYDDENYGNESFPQRRKYKNYGEYENMGNDSEYD
EDEDNEDETNEQYDNSLYPQDKETRNKYSQNYNDIENSNSSKYLNARMGNKENVNLYDPN
KKRDGRRGRKKKKGVYAYKQNNLYYKSLQSRENNNMEEENNDFFFSSSNIKKEDLLTCAP
CGSLIEVLKKKKFILDDINNSSNIANNNSNNKTINMSREAFSWFLKDIRSRIISLVIEYL
LIIDDGNVTNIAKQNSAKHKKKNNSENVTSSEGNEALANSSITNTLINDFNNNDNNNNNM
NGGEWGTNNEDMNNADGVNIKDTQDYITDPNKNSQKSEIYVKETLLLILSLTQCNIGQPI
FLENLTKAQKEFVDFGIHIGLFLKTHDSYIFITPYALLLTINNLNVENYISILNHLSVEK
FCEESGYNNNDDENIKKKAKLSEIYFHKYLLLQNTVRVKSEPLMDEDEKKNLKKIETKNL
ISQDITNHNIHSEKRLNENDNLEIGLIIQSNFKVYLYTSSILKINILSHLCELQARTPNM
VVGILTRRSVLNAYNSDITADQIIKFLESYSHPGKTKLKSIIPINVITQLKLWEAERHRL
TLEDSIVFKNFEKEYLPHLYQQIVIWANSKNYLLHYTPWPKNTNSTEFDAWMKAEKYLCC
IYESKNEIIDKIKEIRGKLMKKRQAI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcacgaaaaaatattgagaatatggaaatatatgattacatgaaggagatg
gatgaaaaagtatgggaatatttgtttgatgattcactagcacatgaaactatatttagc
tcactaaatgaattagagcaaattataatatctagactattgtttattcaacaagtagtt
tcagaaagagctatgagattatggataaatccaaactttttgaaaaaattaagtgaaagt
ataaaaaatttagttgatgttaaaatattagtagaaagtgaaacaaaaaaagataactat
aatcaatataaaataaatgatcgattcagattaacattattaaataaaatatatcaaaat
gataaaaataatatttttatatttaataataatataaaactacaattaaataaagaaaaa
gaattatatgaaaaaaaattatttcctacaaaagaaggtattctatgttatgctaataca
cgatggaatactctcttacattttattgcttcaccaaatttgaatagttataaatatacc
catagttatagtggtagttatgctagtacatacccacatagtagcagtattcatggtggt
atagaatctcctattaaaactgaagtgggtggatcactcgatgtaaataatattcactct
tatggaggagagtattcttataataacagtttgaaaagtgtaaaaatggaaaaaggaaac
tattatggtattcaaactaaaaaaggcaaaaaaaataatgaagatagtgatgaagaatat
caaccttatggtgatgaaatgtatgatgacgaaaattatggaaacgaatcatttccacaa
agaaggaaatataaaaattatggagaatatgaaaacatgggaaatgattcagaatatgat
gaagatgaagataatgaagatgaaacaaatgaacaatatgacaattcattatacccacaa
gataaagaaacccgaaataaatattcacagaattataatgacattgaaaatagtaatagt
agtaaatatttaaacgcaagaatgggtaataaagaaaatgtaaatttatatgatccaaat
aaaaaaagagatggaagacgaggaagaaaaaaaaaaaaaggagtatatgcatataaacaa
aataatttatattataaaagtcttcaaagtagagaaaataataatatggaagaagaaaat
aatgatttttttttttcttcatcaaatattaaaaaagaagatttgttaacatgtgcaccg
tgtggtagtttgatagaagttttgaaaaaaaaaaaatttatacttgatgatataaataat
agttctaatattgctaataataatagtaataataaaacgataaatatgagtagagaagca
ttttcatggtttttaaaagatatacgaagtagaataatatctctagttattgaatatttg
ctgataattgatgatggaaatgtaacaaatatagctaagcaaaattcagctaaacataaa
aaaaaaaacaattcagaaaatgtgacttctagtgaaggaaatgaagctttagcaaatagt
tccatcacaaatactcttataaatgattttaacaataatgataataataataataatatg
aacggaggggaatggggtactaacaatgaagatatgaataatgcagatggtgtaaatata
aaagatacacaagattatataacagatccaaataaaaattctcaaaaatctgagatatat
gtaaaagaaacattattattaattttatcactaactcaatgtaatattggtcaaccaata
tttttagaaaacttaacaaaagctcaaaaagaatttgtagattttggtatacatataggg
ttatttttaaaaacacatgatagttatatatttataacaccatatgcattattattaaca
ataaataatttaaatgttgaaaattatatatctatattaaatcatttatctgtagaaaaa
ttttgtgaagaatctggttataataataatgatgatgaaaatataaaaaaaaaagcaaaa
ttaagtgaaatatattttcataaatatttattattacaaaatacggttcgtgtgaaaagt
gaaccactaatggatgaggacgagaaaaaaaatttgaaaaaaattgaaacaaaaaatttg
atttcgcaagacataactaatcacaatatacattcagaaaaaaggttaaatgaaaatgat
aatttagaaatagggttaatcattcaaagtaattttaaagtttatttgtatacttcgtct
attttaaaaataaatattttaagccacttatgtgaattacaagcaagaacaccaaatatg
gttgttggtatattaacaagaagaagtgtattaaatgcatataattcagatattaccgct
gatcaaattattaaatttttagaatcttattcacatcctggaaaaactaaattaaaaagt
ataataccaattaatgttattactcagcttaaattatgggaagctgaaagacatcgatta
acattagaagattctattgtttttaaaaatttcgaaaaagaatatttaccacatttatat
caacaaattgttatttgggctaatagcaaaaattatttattacattatactccatggcca
aaaaatactaattccactgaatttgatgcatggatgaaagcagaaaaatatctatgttgt
atatatgagtcgaaaaatgaaattattgataagataaaggaaattcgtggtaagttaatg
aaaaaacgtcaggcaatatga

DBGET integrated database retrieval system