KEGG   Plasmodium yoelii: PY06107Help
Entry
PY06107           CDS       T01035                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
pyo  Plasmodium yoelii
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PY06107
  Replication and repair
   03420 Nucleotide excision repair
    PY06107
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PY06107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MNYPENTSHIKKWFFKSRQEIDDICLKKYNDFKEKFKTYNVSIPKYADIEKTKLYFCYQL
THFCDIKRLQPQIVECAIVLYNRFYLKEIILEYDPRILIFTCIILAIKLEGYGRLYKINE
FFSDIDINLDKVLEHENVVCSSLDFELNFLYTKECIFYLKNQFLNYINKYINKDNEVKNS
FENICDKIYVNTSLECLKLLENFFITFTYTPAQIALYCFINNIKINFNIVNADKFILEFI
TNNNQILFQKLKNKIDELHIKYKDHFDLRNTFDDENTTKQIGETLDMCIDIYDILKKKKS
HKKSKKNKLNNQNSEQNESKKMASIK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattacccagaaaatacatcacatattaaaaaatggtttttcaaaagcagacaagaa
atagatgatatttgtttaaaaaaatataatgatttcaaagaaaaatttaaaacatacaat
gtgagcatacctaaatacgctgatatagaaaaaacaaagttatatttttgctatcaacta
acacatttttgtgatataaaaagattacagcctcaaatagtggaatgcgctattgtattg
tataatagattttatttgaaagaaataattttagaatatgaccctcgcatcttaatattt
acttgcattatattagcaataaagttagaaggatatggcaggttgtataaaatcaatgaa
ttttttagcgatatagatattaacttagataaagttttagaacatgaaaatgttgtttgc
tcatcattagattttgaattgaattttttatatactaaagaatgcattttttatttaaaa
aaccaatttttaaattatataaataaatatataaataaagacaacgaagtaaaaaattcc
tttgaaaatatctgtgataaaatatatgttaatacttcattggagtgtttaaaacttcta
gaaaacttttttataacatttacttacacacccgctcaaatagcattatactgttttata
aataatattaaaataaattttaatattgtaaatgccgataaatttatattggaatttatt
acaaataataatcaaatcctttttcaaaagttgaaaaataaaatagatgaactccacatt
aaatataaagatcattttgatttgagaaatacatttgatgatgaaaatactacgaaacag
ataggagagactttggatatgtgtattgatatttacgatattttaaaaaaaaaaaaaagt
cataaaaagtctaagaaaaataaattaaacaatcaaaatagtgaacaaaatgaatctaaa
aaaatggcaagcataaaataa

DBGET integrated database retrieval system