KEGG   Plasmodium yoelii: PY06107Help
Entry
PY06107           CDS       T01035                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
pyo  Plasmodium yoelii
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:pyo03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:pyo03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MNYPENTSHIKKWFFKSRQEIDDICLKKYNDFKEKFKTYNVSIPKYADIEKTKLYFCYQL
THFCDIKRLQPQIVECAIVLYNRFYLKEIILEYDPRILIFTCIILAIKLEGYGRLYKINE
FFSDIDINLDKVLEHENVVCSSLDFELNFLYTKECIFYLKNQFLNYINKYINKDNEVKNS
FENICDKIYVNTSLECLKLLENFFITFTYTPAQIALYCFINNIKINFNIVNADKFILEFI
TNNNQILFQKLKNKIDELHIKYKDHFDLRNTFDDENTTKQIGETLDMCIDIYDILKKKKS
HKKSKKNKLNNQNSEQNESKKMASIK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattacccagaaaatacatcacatattaaaaaatggtttttcaaaagcagacaagaa
atagatgatatttgtttaaaaaaatataatgatttcaaagaaaaatttaaaacatacaat
gtgagcatacctaaatacgctgatatagaaaaaacaaagttatatttttgctatcaacta
acacatttttgtgatataaaaagattacagcctcaaatagtggaatgcgctattgtattg
tataatagattttatttgaaagaaataattttagaatatgaccctcgcatcttaatattt
acttgcattatattagcaataaagttagaaggatatggcaggttgtataaaatcaatgaa
ttttttagcgatatagatattaacttagataaagttttagaacatgaaaatgttgtttgc
tcatcattagattttgaattgaattttttatatactaaagaatgcattttttatttaaaa
aaccaatttttaaattatataaataaatatataaataaagacaacgaagtaaaaaattcc
tttgaaaatatctgtgataaaatatatgttaatacttcattggagtgtttaaaacttcta
gaaaacttttttataacatttacttacacacccgctcaaatagcattatactgttttata
aataatattaaaataaattttaatattgtaaatgccgataaatttatattggaatttatt
acaaataataatcaaatcctttttcaaaagttgaaaaataaaatagatgaactccacatt
aaatataaagatcattttgatttgagaaatacatttgatgatgaaaatactacgaaacag
ataggagagactttggatatgtgtattgatatttacgatattttaaaaaaaaaaaaaagt
cataaaaagtctaagaaaaataaattaaacaatcaaaatagtgaacaaaatgaatctaaa
aaaatggcaagcataaaataa

DBGET integrated database retrieval system