KEGG   Plasmodium yoelii: PY17X_1363400Help
Entry
PY17X_1363400     CDS       T01035                                 

Gene name
PY06210
Definition
(RefSeq) aspartate carbamoyltransferase, putative
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00240  Pyrimidine metabolism
pyo00250  Alanine, aspartate and glutamate metabolism
pyo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PY17X_1363400 (PY06210)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PY17X_1363400 (PY06210)
Enzymes [BR:pyo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PY17X_1363400 (PY06210)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 3792152
NCBI-ProteinID: XP_022813742
Position
13
AA seq 372 aa AA seqDB search
MGRIIDSILSGGVILTATLLTCKYLKDRKRKLTIEGQCEAKNKFNIDLNKIIEKMKNKNI
INIDDINDEELLAILFTAKTFEKILRDKKDSKYLKDKVFCSLFTEPSTRTRCSFDSAILR
LGSKVINITDVNSTSFYKGETVQDTFSVMSKYVDGIIYRDASNNNIELAIETSSKPIINA
GNGTGEHPTQSLLDFYTIYNFFPYILDRNPNKKLKVAFVGDLKNGRTIHSLSKLLSRYNV
SFNFISCKSLDIPNNIINIISDNLKKNNFYDENSINKYDNLEKGLEGTHIVYMTRIQKER
FSDMSEYNKYKDSFILDNNALKNTRPDAKVLHPLPRVNEIKIEVDENPKSVYFLQAENGL
YVRMALLYLIFS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggatcattgattcgatactttcaggaggcgttattttaacagccacattatta
acatgcaaatatcttaaagacagaaaaaggaaactaacaattgaagggcaatgtgaagca
aaaaataaattcaatatcgatctgaataaaataatagaaaaaatgaaaaataaaaatatt
ataaacattgatgatataaatgatgaagaattgttagcaattttatttacagcaaaaaca
tttgaaaaaatattaagagataagaaggactccaaatatttgaaagataaagttttctgt
agtttatttactgaaccaagcacacgaacgagatgctcttttgattctgctattttaaga
ttgggttcaaaagtaataaatattacggatgtaaattcaacttccttttataaaggagaa
actgtgcaggatactttttctgttatgtcaaaatatgttgacggaattatatacagagat
gcctcaaataataatatcgaattggcaattgaaacatcaagtaagccaataatcaacgcg
gggaatggaactggagaacatccaacacaatcactcttagacttttatacaatatataat
tttttcccatatattttggatagaaatccaaacaaaaaacttaaggttgcatttgttggt
gatttaaaaaatggaagaactattcattctcttagtaaattacttagtagatataatgtt
agtttcaattttatttcatgtaaatcattagatattcctaataatataataaatattata
tctgataatttgaaaaaaaataatttttatgacgagaattctataaacaaatatgataat
ttagaaaagggattagagggtactcatattgtatatatgacgagaattcaaaaagaaaga
ttttcagatatgagcgaatataacaaatacaaagattctttcattttggataacaacgca
ttaaaaaatacaagacccgacgccaaggtccttcacccccttccaagggttaacgaaata
aaaatagaggttgatgaaaatcctaaaagtgtatattttttgcaagctgaaaatggccta
tatgtacgaatggcattattataccttattttctcataa

DBGET integrated database retrieval system