KEGG   Plasmodium yoelii: PY06874Help
Entry
PY06874           CDS       T01035                                 

Definition
protein serine/threonine kinase-1
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PY06874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 733 aa AA seqDB search
RNKRNRSYEXLSTSKYKXXYXKKYKGYGINDHIIRGYNKNVRKRSCSSTKKLYDKDPKHY
KVYLESRYNEDYRNKYIKNYNLSKKRTYYSYKKKLFSDRRYYDTHFGQGNIFYNNEYYLI
NDSSTLKRKKMYYGSSYKTESGSYNNTDLEKKNLNKRKLYSNRREIYAGHDKKISSKDDY
NYNYYYKKKYDRNKGNNYLLKKNSSIITNNKDSPRKDYGKVYKEYDDYKNKTGKNMDYYY
YNNNKIKKKNNISYNYSNNKINRKRRYIIDSKSDNSQINGFNKGHSTCEQSLSDSSRDSS
YYDKVKKKKKKYKEAKNRISSDNDSRRGMIDESRGNSDSYESSYENDNKTKKGNKRYRTE
TSKSSSRNESMRKQKKKKVNDNNYSDDEIVHFSWEKGMILNDHYKVMRKMGDGTFGRVLL
CQHIVNKKYYAVKVVRNVKKYTKSAKIEADILKKIQSNDIKNNNIVRYHGKFMYHDHMCL
IFEPLGPSLYEIITKNDYNGFHIEDIKLYCIEILKALHYLRKIKLTHTDLKPENILLDDP
HFEKKIVTVKRVTDGKKIQIYRSKSKGIKIIDFGCATFKSDYHGSIINTRQYRAPEVILN
LGWDVSSDMWSFGCILAELYTGNLLFKTHEHLEHLALMENIIEPIPKKMLYEATKTNGYK
YIDKKNLRLAWPENASSIDSIKHVKKSLPLYNIIKHDLFCDFLYNILRIDPTRRASPIDL
LKHEFLEGNYEDF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
cgaaacaaaagaaatcgaagttatgaargcttaagcacttcgaaatataaaaakaratat
amcaaaaaatataaaggatatggtataaatgatcatataataagaggatataataaaaat
gtacgaaaaagaagttgttcttcaacaaaaaaattatatgataaagatccaaaacattat
aaagtatatttagagtcaagatataatgaagattatcgaaataaatatataaaaaattat
aatttatcaaaaaaaagaacatattattcttataaaaaaaaattatttagtgataggcga
tattatgatacacattttggccaaggaaatatattttataataatgaatattatttaatt
aatgatagtagtacattaaaaagaaaaaaaatgtattatggaagtagttataaaactgaa
tcaggaagttataataatactgatctagaaaaaaaaaatttgaacaagagaaaactttat
tcaaatagacgtgagatatatgctggtcatgacaaaaaaattagtagtaaagatgattat
aattataattattattataaaaaaaaatatgatagaaataaaggaaataattatttatta
aaaaaaaatagtagtattataacaaataataaagattcaccaagaaaagattatggaaaa
gtctataaggaatatgatgattataaaaataaaacaggtaaaaatatggattattattat
tataataataataaaataaaaaaaaaaaataatatatcttataattatagtaataataaa
ataaatagaaaaagaagatatattattgatagtaaaagtgataatagtcaaattaatgga
tttaataaagggcatagtacatgtgaacagagtttatctgattcatctagggatagtagt
tattatgataaagtgaaaaaaaaaaaaaaaaaatataaagaagcaaaaaatcgaattagt
agtgataatgatagtagaagggggatgattgatgagtctcgaggaaatagtgattcatat
gaatcaagttatgaaaatgataataaaacaaaaaaagggaataaaagatatagaacagaa
acatctaaaagtagtagcagaaatgaaagtatgcgaaaacaaaaaaaaaaaaaagtgaat
gataataattattctgatgatgaaattgttcattttagttgggaaaaaggaatgatttta
aatgatcattataaggttatgagaaaaatgggtgatggaacatttggaagagttttgtta
tgtcagcatattgttaataaaaaatattatgctgtaaaagttgttcgaaacgtaaaaaaa
tatacaaaatcagcaaaaattgaagctgatatattaaaaaaaattcaaagcaatgatata
aaaaataataatatagttagatatcatggtaaatttatgtatcatgatcatatgtgttta
atatttgaacctttaggaccatccctttatgaaataatcacaaaaaatgattataatggt
tttcatattgaagatataaaattatattgtatagaaattttaaaagcattacattattta
agaaaaataaaattaacacacacagatttaaaacctgaaaatattttattagatgaccca
cattttgaaaaaaaaatagtaactgttaaaagagttacagatggaaaaaaaattcaaata
tatcgatctaaatctaaaggaataaaaataattgattttggatgtgctacatttaaaagt
gattatcatggatctataattaatactagacaatatagagccccagaagttatattaaat
ttaggttgggatgtatctagtgatatgtggagttttggttgtatattagcagaattatat
actggtaatttattatttaaaactcatgaacatttagaacatttagcacttatggaaaat
attatagaacctatacctaaaaagatgttatatgaagctacaaaaactaatggttataaa
tatatagataaaaagaatttaagattagcttggcctgaaaatgcatcaagtatagattca
attaagcatgtcaaaaaatctcttcctttatataatattattaaacatgatttattttgt
gactttttatataatatattacgaattgatccaactcgtcgggcttctccgattgattta
ttgaaacatgaatttttagaggggaattatgaggatttttaa

DBGET integrated database retrieval system