KEGG   Plasmodium yoelii: PY17X_1313000Help
Entry
PY17X_1313000     CDS       T01035                                 

Gene name
PY06874
Definition
(RefSeq) serine/threonine kinase-1, putative
  KO
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pyo  Plasmodium yoelii
Brite
Enzymes [BR:pyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PY17X_1313000 (PY06874)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
13
AA seq 811 aa AA seqDB search
MNKNVYNNGMNEKYKNKYRTYYYKYYTNQVKNKYMGFSNIYRNNSPNKYYYEASWRDNNN
NNYYYRYNMNGNGHRHQIRNKRNRSYESLSTSKYKNKYNKKYKGYGINDHIIRGYNKNVR
KRSCSSTKKLYDKDPKHYKVYLESRYNEDYRNKYIKNYNLSKKRTYYSYKKKLFSDRRYY
DTHFGQGNIFYNNEYYLINDSSTLKRKKMYYGSSYKTESGSYNNTDLEKKNLNKRKLYSN
RREIYAGHDKKISSKDDYNYNYYYKKKYDRNKGNNYLLKKNSSIITNNKDSPRKDYGKVY
KEYDDYKNKTGKNMDYYYYNNNKIKKKNNISYNYSNNKINRKRRYIIDSKSDNSQINGFN
KGHSTCEQSLSDSSRDSSYYDKVKKKKKKYKEAKNRISSDNDSRRGMIDESRGNSDSYES
SYENDNKTKKGNKRYRTETSKSSSRNESMRKQKKKKVNDNNYSDDEIVHFSWEKGMILND
HYKVMRKMGDGTFGRVLLCQHIVNKKYYAVKVVRNVKKYTKSAKIEADILKKIQSNDIKN
NNIVRYHGKFMYHDHMCLIFEPLGPSLYEIITKNDYNGFHIEDIKLYCIEILKALHYLRK
IKLTHTDLKPENILLDDPHFEKKIVTVKRVTDGKKIQIYRSKSKGIKIIDFGCATFKSDY
HGSIINTRQYRAPEVILNLGWDVSSDMWSFGCILAELYTGNLLFKTHEHLEHLALMENII
EPIPKKMLYEATKTNGYKYIDKKNLRLAWPENASSIDSIKHVKKSLPLYNIIKHDLFCDF
LYNILRIDPTRRASPIDLLKHEFLEGNYEDF
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaatgtatacaataacggtatgaatgaaaaatataaaaataaatatagaaca
tattactataaatattatacaaatcaagtaaaaaataaatacatggggttttcaaacata
tatagaaacaatagtcccaataaatattattacgaggcatcatggcgtgataataacaat
aataattattactatagatataacatgaatggtaatgggcataggcaccaaatacgaaac
aaaagaaatcgaagttatgaaagcttaagcacttcgaaatataaaaataaatataacaaa
aaatataaaggatatggtataaatgatcatataataagaggatataataaaaatgtacga
aaaagaagttgttcttcaacaaaaaaattatatgataaagatccaaaacattataaagta
tatttagagtcaagatataatgaagattatcgaaataaatatataaaaaattataattta
tcaaaaaaaagaacatattattcttataaaaaaaaattatttagtgataggcgatattat
gatacacattttggccaaggaaatatattttataataatgaatattatttaattaatgat
agtagtacattaaaaagaaaaaaaatgtattatggaagtagttataaaactgaatcagga
agttataataatactgatctagaaaaaaaaaatttgaacaagagaaaactttattcaaat
agacgtgagatatatgctggtcatgacaaaaaaattagtagtaaagatgattataattat
aattattattataaaaaaaaatatgatagaaataaaggaaataattatttattaaaaaaa
aatagtagtattataacaaataataaagattcaccaagaaaagattatggaaaagtctat
aaggaatatgatgattataaaaataaaacaggtaaaaatatggattattattattataat
aataataaaataaaaaaaaaaaataatatatcttataattatagtaataataaaataaat
agaaaaagaagatatattattgatagtaaaagtgataatagtcaaattaatggatttaat
aaagggcatagtacatgtgaacagagtttatctgattcatctagggatagtagttattat
gataaagtgaaaaaaaaaaaaaaaaaatataaagaagcaaaaaatcgaattagtagtgat
aatgatagtagaagggggatgattgatgagtctcgaggaaatagtgattcatatgaatca
agttatgaaaatgataataaaacaaaaaaagggaataaaagatatagaacagaaacatct
aaaagtagtagcagaaatgaaagtatgcgaaaacaaaaaaaaaaaaaagtgaatgataat
aattattctgatgatgaaattgttcattttagttgggaaaaaggaatgattttaaatgat
cattataaggttatgagaaaaatgggtgatggaacatttggaagagttttgttatgtcag
catattgttaataaaaaatattatgctgtaaaagttgttcgaaacgtaaaaaaatataca
aaatcagcaaaaattgaagctgatatattaaaaaaaattcaaagcaatgatataaaaaat
aataatatagttagatatcatggtaaatttatgtatcatgatcatatgtgtttaatattt
gaacctttaggaccatccctttatgaaataatcacaaaaaatgattataatggttttcat
attgaagatataaaattatattgtatagaaattttaaaagcattacattatttaagaaaa
ataaaattaacacacacagatttaaaacctgaaaatattttattagatgacccacatttt
gaaaaaaaaatagtaactgttaaaagagttacagatggaaaaaaaattcaaatatatcga
tctaaatctaaaggaataaaaataattgattttggatgtgctacatttaaaagtgattat
catggatctataattaatactagacaatatagagccccagaagttatattaaatttaggt
tgggatgtatctagtgatatgtggagttttggttgtatattagcagaattatatactggt
aatttattatttaaaactcatgaacatttagaacatttagcacttatggaaaatattata
gaacctatacctaaaaagatgttatatgaagctacaaaaactaatggttataaatatata
gataaaaagaatttaagattagcttggcctgaaaatgcatcaagtatagattcaattaag
catgtcaaaaaatctcttcctttatataatattattaaacatgatttattttgtgacttt
ttatataatatattacgaattgatccaactcgtcgggcttctccgattgatttattgaaa
catgaatttttagaggggaattatgaggatttttaa

DBGET integrated database retrieval system