KEGG   Plasmodium yoelii: PY06980Help
Entry
PY06980           CDS       T01035                                 

Definition
thioredoxin
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pyo  Plasmodium yoelii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PY06980
Enzymes [BR:pyo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PY06980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MKLYGKIHFILPVLYLFAKYASSLYTNVKEIKTVESLKEFDELINSEKKCLVQFYATWCR
VSRGFSNDFINIAKTVKDDILVIAIKNEDIINKYKIQTYPNIQLFFTNDKKEKHIEQFDG
NYKIKDVVSFIYDNIKNYRLKELNIDVGKKDSSNKKNKKNKNSGKVIVLNDSNFDQNVLK
NDDNVWFVFFYAPWCGHSKPIHPMFDELAKKTSHLKNAKIAKIDATVEQRTAQIYEIKHY
PSFRLFPSGNKKPHTAIDYNEARTVNDLYQFFLKYYKEKKEIIQLTSRNVFDEHCENDVC
LLAILPSKEDIEPSSLKAYIQILTSVIKDVNHLPVTLMWTHAGDQLDIVQKLNLTFGFPT
VIAISFSKNVYSILKGNYSEQSIKNFVIQMMTGKSSVDNLVPFKIRLLHIYIYIYIYFFY
ASIFFNNYLQKKRTNFQR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctatggaaaaatacacttcatactacccgtactttacctttttgcaaaatat
gcaagtagcttatatacaaatgtaaaagaaattaaaacagtagagtcccttaaagaattt
gatgaattaataaattctgaaaaaaaatgcttagttcaattttatgctacatggtgtcga
gtttctagaggtttctctaacgattttataaatatagcaaaaacagtcaaagatgatata
ttagttatagctataaaaaatgaagatataataaataaatataaaattcaaacttaccca
aatatacaactattttttactaatgataaaaaagaaaagcatattgaacaatttgatgga
aattataaaataaaagatgttgtttcatttatatatgataatattaaaaattaccgttta
aaagagttaaatattgatgttggtaaaaaagatagttcaaataaaaaaaataaaaaaaat
aaaaatagtggtaaagtaattgtattaaatgattcgaactttgatcaaaatgttttaaaa
aatgatgataatgtatggtttgtttttttctatgctccatggtgtgggcatagtaaacct
attcatccaatgtttgatgagctagctaaaaaaacatcgcatttaaagaatgcaaaaata
gcaaaaattgatgcaactgttgaacaaagaacagcacaaatttacgaaataaaacattat
ccttctttccgtttatttccatcaggaaataaaaaaccacacactgctatagattataac
gaggctagaactgttaatgatctatatcaattttttttaaaatattataaagaaaaaaaa
gaaataatacaattaacatctcgaaatgtttttgatgaacattgtgaaaatgatgtttgc
cttttagctatattaccaagtaaagaagatattgaaccaagttctttaaaagcttatatt
caaatattaactagtgtaataaaagatgttaaccatcttcctgttactctaatgtggaca
catgcaggagatcaattagatatagttcaaaaattaaatttaacatttggatttccaact
gttattgctattagtttttcaaaaaatgtttattcaattttaaaaggaaattattctgaa
caatcaatcaaaaattttgttatacaaatgatgacaggaaaatcatcagtagacaatttg
gttccatttaagattcgattactgcatatatatatatacatatatatatattttttttat
gcgtccattttttttaacaattatttgcaaaaaaaacgaacaaatttccaacgttaa

DBGET integrated database retrieval system