KEGG   Plasmodium yoelii: PY07156Help
Entry
PY07156           CDS       T01035                                 

Definition
serine/threonine protein phosphatase alpha-3 isoform
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pyo  Plasmodium yoelii
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pyo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PY07156
Enzymes [BR:pyo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PY07156
Protein phosphatases and associated proteins [BR:pyo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PY07156
Transcription machinery [BR:pyo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PY07156
Spliceosome [BR:pyo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PY07156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC
GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN
MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK
KITT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatagatatagataatgtaatatcgaaactaatagaagttagaggaaca
cgaccagggaaaaatgtaaatttgacagaaaatgaaatcaaaattttatgtttgtcgagt
agagaaatttttttaaatcaaccaatattattagaattagaagctccgatcaaaatatgt
ggagacattcatggacagttttatgatttgttaagattatttgaatatggcggtttccct
ccggatgccaattatttatttttaggcgactatgtcgatagaggaaaacaaagcttagaa
acaatctgtctattattagcatataaaataaaatatcctgaaaattttttcttattaagg
ggaaatcatgaatgtgcatctataaatagaatctacggtttttatgatgaatgcaaaaga
agatatagtgttaaactatggaaaacttttatagattgctttaactgtttaccagtagct
gctataatagatgaaaaaattttttgtatgcatggtggattatcaccagaattaaataat
atggagcagattcgaaaaataacaagacccacagatgtgccagataatggcttattgtgt
gacttattatggtcagatcccgaaaaggaaataaacggatggggagaaaatgacagaggt
gtttcatttacatttggtcaagatgtagttcataattttttaagaaaacatgaacttgat
cttatatgtagagcccatcaagttgtagaagatggatatgaattttttgcaaaaagacaa
ttagttactttattttcagctccaaattattgtggagaatttgataatgcaggagctatg
atgagtgttgatgagactctcatgtgctcatttcaaattttaaagccagttgaaaaaaag
aaaataacgacatga

DBGET integrated database retrieval system