KEGG   Plasmodium yoelii: PY17X_1030700Help
Entry
PY17X_1030700     CDS       T01035                                 

Gene name
PY07156
Definition
(RefSeq) serine/threonine protein phosphatase, putative
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
10
AA seq 304 aa AA seqDB search
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC
GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN
MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK
KITT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatagatatagataatgtaatatcgaaactaatagaagttagaggaaca
cgaccagggaaaaatgtaaatttgacagaaaatgaaatcaaaattttatgtttgtcgagt
agagaaatttttttaaatcaaccaatattattagaattagaagctccgatcaaaatatgt
ggagacattcatggacagttttatgatttgttaagattatttgaatatggcggtttccct
ccggatgccaattatttatttttaggcgactatgtcgatagaggaaaacaaagcttagaa
acaatctgtctattattagcatataaaataaaatatcctgaaaattttttcttattaagg
ggaaatcatgaatgtgcatctataaatagaatctacggtttttatgatgaatgcaaaaga
agatatagtgttaaactatggaaaacttttatagattgctttaactgtttaccagtagct
gctataatagatgaaaaaattttttgtatgcatggtggattatcaccagaattaaataat
atggagcagattcgaaaaataacaagacccacagatgtgccagataatggcttattgtgt
gacttattatggtcagatcccgaaaaggaaataaacggatggggagaaaatgacagaggt
gtttcatttacatttggtcaagatgtagttcataattttttaagaaaacatgaacttgat
cttatatgtagagcccatcaagttgtagaagatggatatgaattttttgcaaaaagacaa
ttagttactttattttcagctccaaattattgtggagaatttgataatgcaggagctatg
atgagtgttgatgagactctcatgtgctcatttcaaattttaaagccagttgaaaaaaag
aaaataacgacatga

  All links  
No link information was found.   
DBGET integrated database retrieval system