KEGG   Pyrobaculum sp. 1860: P186_0397Help
Entry
P186_0397         CDS       T01670                                 

Definition
fuculose-1-phosphate aldolase (fucA)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    P186_0397
Enzymes [BR:pyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     P186_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(348185..348784)
Genome map
AA seq 199 aa AA seqDB search
MSIPLLRVSVVDELVRYTRLLYERGHLTLLSGNVSVSVDGLFVVTPTSYPKPFLEAGDLV
WINGEGEVVKGRLRPTSEWRMHVAIYRRRRDVGAVVHTHDVLPTLLAERIEADLLSEAEA
YLGSGIAVVPYIQPGTAELAEAVAAALEKSNVAILKRHGVVAVGRDLAEAVNRIEVVADL
ARATFYKWVMELWSAKRGD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctatacctcttctgcgtgtgtctgtggtagatgagttggttagatacactcgtctg
ctttatgagagggggcatttgactctgctctctggtaatgtttctgtgtctgtggacggg
ctgtttgtcgtcacgccgacctcctacccgaagccgtttctcgaggcgggggacctggtg
tggatcaacggcgagggagaggtggtcaaggggaggctcaggcccacaagcgagtggcgt
atgcacgtcgcaatatatagaaggaggagggatgtcggcgccgtcgtccatacccatgac
gtattgcctacgctactcgccgagaggatagaggcggatctcctctccgaggccgaggcc
tacctggggtcggggatagccgtggtgccctacatccagccggggactgccgagctcgcc
gaggccgtcgccgcggcgcttgagaagagcaacgtggctatcttgaagcgacacggcgtg
gtggccgtgggcagagacctagccgaggctgtgaacaggatagaggtcgtggctgatctg
gcgagggccacgttctacaagtgggtaatggagttatggagtgccaagagaggcgactag

DBGET integrated database retrieval system