KEGG   Pyrobaculum sp. 1860: P186_0566Help
Entry
P186_0566         CDS       T01670                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit (sucC)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_0566
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P186_0566
   00640 Propanoate metabolism
    P186_0566
   00660 C5-Branched dibasic acid metabolism
    P186_0566
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_0566
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     P186_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
492427..493575
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKESFSKYGVRIPPGRVATTPEEVRRIASELGPPVVLKAQVVVAGRGKAGGIK
TANTPEEAYEFSQKMFGMNIKGLAVKKIYVTKYVEVSREMYLSLIIDRATRRYLFLVSPI
GGVDIEEIAKTAPEKIKRVYVDPFVGLRDYHVRAIVSWLGFQQGTPQWQQAASIVNAMYR
IMVDYDAELVESNPLALTKDGDVIPLDARVIVDDNSLYRHPDLEKALEEDPRDVTEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASREVVREAVKV
LLNHPRVKVIFINIFGGITRADEVAWGVRDALAQTGGAGKNIVVRMKGTNEELGKAILAE
VGIPLFESAEEAAKKAVELAGA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacatgagtatgaagctaaggaatcgttttcaaaatacggggttagaatcccg
ccgggcagagttgcgacaacgcctgaggaagtccgcagaattgccagcgagctggggccg
cctgttgttctcaaggcgcaggtcgtggtggcggggaggggcaaagccggcggtataaag
acggcgaatacgccggaggaggcgtacgagttttcacagaagatgtttggtatgaatatc
aaggggcttgctgtgaagaagatctacgtcacgaaatacgtcgaggtgagtagggagatg
tatctatcgctgatcattgacagggcaacgcgtagatatctgtttctcgtgtcgccaata
ggcggcgtggatatcgaagagattgccaagaccgcccctgaaaagattaagcgagtctac
gtggatccctttgtggggctgagggattaccatgtaagagctatagtgtcttggctcggc
ttccagcagggcaccccccagtggcaacaagcggcgtctattgtaaatgctatgtataga
ataatggtggactacgacgccgagttggtagagagcaacccgctggcgcttacaaaagac
ggggacgtcatacccctcgacgccagggtgatagtcgacgacaactcgctgtatagacac
ccagatttagaaaaagccctggaggaggatccccgagacgtgacggagttcgaggcgtat
gcgaagaaaatcggcttccactacgtcgagctcgacggggacatcggtataattgggaac
ggggccgggctcacgatgtccaccatggaccttgtgtaccacttcggcgggaggccggcg
aacttcctagatatcggcggcggggctagcagagaggtggtgagggaggcggtcaaggtg
ctcctcaaccaccccagagtcaaggtgatttttataaatatcttcggcggcataactagg
gcggatgaggtggcctggggggtgagggacgcccttgctcagaccggcggggctggcaag
aatattgtggtaaggatgaagggcaccaacgaggagctgggcaaggccatacttgccgag
gtcgggattccgctttttgaaagtgcagaggaggcggctaagaaagctgtcgagctggcg
ggggcatga

DBGET integrated database retrieval system