KEGG   Pyrobaculum ferrireducens: P186_0566Help
Entry
P186_0566         CDS       T01670                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit (sucC)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00020  Citrate cycle (TCA cycle)
pyr00640  Propanoate metabolism
pyr00660  C5-Branched dibasic acid metabolism
pyr00720  Carbon fixation pathways in prokaryotes
pyr01100  Metabolic pathways
pyr01110  Biosynthesis of secondary metabolites
pyr01120  Microbial metabolism in diverse environments
pyr01130  Biosynthesis of antibiotics
pyr01200  Carbon metabolism
Module
pyr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pyr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pyr_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    P186_0566
   00640 Propanoate metabolism
    P186_0566
   00660 C5-Branched dibasic acid metabolism
    P186_0566
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_0566
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     P186_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AET32018
UniProt: G7VHB5
Position
492427..493575
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKESFSKYGVRIPPGRVATTPEEVRRIASELGPPVVLKAQVVVAGRGKAGGIK
TANTPEEAYEFSQKMFGMNIKGLAVKKIYVTKYVEVSREMYLSLIIDRATRRYLFLVSPI
GGVDIEEIAKTAPEKIKRVYVDPFVGLRDYHVRAIVSWLGFQQGTPQWQQAASIVNAMYR
IMVDYDAELVESNPLALTKDGDVIPLDARVIVDDNSLYRHPDLEKALEEDPRDVTEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASREVVREAVKV
LLNHPRVKVIFINIFGGITRADEVAWGVRDALAQTGGAGKNIVVRMKGTNEELGKAILAE
VGIPLFESAEEAAKKAVELAGA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacatgagtatgaagctaaggaatcgttttcaaaatacggggttagaatcccg
ccgggcagagttgcgacaacgcctgaggaagtccgcagaattgccagcgagctggggccg
cctgttgttctcaaggcgcaggtcgtggtggcggggaggggcaaagccggcggtataaag
acggcgaatacgccggaggaggcgtacgagttttcacagaagatgtttggtatgaatatc
aaggggcttgctgtgaagaagatctacgtcacgaaatacgtcgaggtgagtagggagatg
tatctatcgctgatcattgacagggcaacgcgtagatatctgtttctcgtgtcgccaata
ggcggcgtggatatcgaagagattgccaagaccgcccctgaaaagattaagcgagtctac
gtggatccctttgtggggctgagggattaccatgtaagagctatagtgtcttggctcggc
ttccagcagggcaccccccagtggcaacaagcggcgtctattgtaaatgctatgtataga
ataatggtggactacgacgccgagttggtagagagcaacccgctggcgcttacaaaagac
ggggacgtcatacccctcgacgccagggtgatagtcgacgacaactcgctgtatagacac
ccagatttagaaaaagccctggaggaggatccccgagacgtgacggagttcgaggcgtat
gcgaagaaaatcggcttccactacgtcgagctcgacggggacatcggtataattgggaac
ggggccgggctcacgatgtccaccatggaccttgtgtaccacttcggcgggaggccggcg
aacttcctagatatcggcggcggggctagcagagaggtggtgagggaggcggtcaaggtg
ctcctcaaccaccccagagtcaaggtgatttttataaatatcttcggcggcataactagg
gcggatgaggtggcctggggggtgagggacgcccttgctcagaccggcggggctggcaag
aatattgtggtaaggatgaagggcaccaacgaggagctgggcaaggccatacttgccgag
gtcgggattccgctttttgaaagtgcagaggaggcggctaagaaagctgtcgagctggcg
ggggcatga

DBGET integrated database retrieval system