KEGG   Pyrobaculum sp. 1860: P186_0611Help
Entry
P186_0611         CDS       T01670                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_0611
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_0611
   00052 Galactose metabolism
    P186_0611
   00500 Starch and sucrose metabolism
    P186_0611
   00520 Amino sugar and nucleotide sugar metabolism
    P186_0611
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    P186_0611
   00524 Butirosin and neomycin biosynthesis
    P186_0611
Enzymes [BR:pyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     P186_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(533786..534724)
Genome map
AA seq 312 aa AA seqDB search
MAHTGGVNLITAPCSYVALYLGVDVGATWTRAVLVDTNARVLNRIKIKTGVNPLADVAAA
VENWEFDSIGVGSIGPMDLRSGWVVNSPNSPSRQFPLVDPLKRLGKPVVVANDCVAAVWG
EYVFRHRVDNLVYITLSTGVGIGAIVNGTLLLGKDGNAHELGHAVIDFRQGRPCGCGGVG
HFEAYVGGANMPRWFHEVTGEGPAEPAEIFRRHREGDPKARQFVDMWLEALAAGVATVVA
AYDPELLLMGGSIALNNWDLISQELPRRLRKYLGVRPPEIKQASFGDDEVAIGAAALAYK
IPDSLRKFGYPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggcccacaccgggggcgtgaatttaataacagctccatgtagctacgtggcgttgtat
ctaggcgttgacgtcggggccacgtggactagagccgttcttgtagacactaatgcccgt
gtattaaatagaataaagataaagacgggcgtcaacccgctcgccgatgtggccgcggcg
gtggaaaactgggagtttgacagtataggagtagggtcaataggcccgatggatctcaga
agcggctgggtggttaattcgcctaattcgccctctaggcagttcccactcgtagatccg
ctgaagagacttggaaaacccgtagtggttgctaacgactgcgtcgccgcggtgtgggga
gaatacgtctttagacaccgtgtagataacctagtctacataacactgtcaaccggcgtg
gggataggggcgatcgtcaacggcacgctactactaggcaaggacggaaatgcacacgag
ctgggacacgcagttatcgatttccgccagggacggccatgcggctgcggtggagtcgga
cacttcgaggcgtacgtgggaggcgccaacatgcccaggtggtttcacgaggtgacggga
gagggtccggctgagccggcagagatatttagacggcacagagagggggatccaaaggcg
aggcagttcgtcgacatgtggctcgaggcactcgccgcaggcgtggccaccgtggtggcc
gcatacgacccagagctgttgctaatggggggctcaatagcgctgaacaactgggacctc
atatcacaagagttgccaagacggcttaggaaatacctaggggtgaggccgcctgagata
aaacaagcctctttcggcgacgacgaagtggccatcggcgccgccgcgctcgcctacaag
ataccagacagcttgaggaagtttggataccctagatag

DBGET integrated database retrieval system