KEGG   Pyrobaculum sp. 1860: P186_1154Help
Entry
P186_1154         CDS       T01670                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pyr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pyr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pyr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968760..970040
Genome map
AA seq 426 aa AA seqDB search
MGVKVFKQLLSGAYVGVVSRWYNIAADLPIALSPPRDPDEGESRIGLLSKILPSALIDQE
FTAERWVSIPEEVRDVYRRVGRPTPLFRAEGLERALGVKTRIYYKFEGVLPVGSHKLNTA
VAQAYYAKADGAVEVATETGAGQWGMAVSLAAALFGLKAVVFMTRSSYNSKRQRLTFMRT
YGAVVYPSPSEVTEAGRRHYRPDHPGSLGIAISEAVEYVLSGERRRYLPGSVMEFVLMHQ
TVIGLEAVEQLPEEPDVAVACVGGGSNFAGFTYPMIGMRLRGEGFEKTRFVAVESEAAPK
LTRGEYKYDFPDAVGVLPMLKMYTLGHDYVPPAIHAAGLRYHGAAPSLSLLKRLGIVEPL
AYPQEEVMKAAVLFARSEGVVPAPESAHAIRAVIDLAKKLPDGSVIAFNLSGHGLLDADA
YEKFLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgggggttaaagtttttaagcaactcctatctggggcttatgtcggggtggtgagccgt
tggtataacatcgccgcggatctgccgattgccctctcgccgccgagggatcccgacgag
ggtgagagcaggattggcctcctcagcaagatcctgccctctgctttaatcgaccaggag
ttcaccgcggagcggtgggtatctatcccggaggaggtgcgggatgtctacagacgggtg
gggcggccgacgccccttttcagagccgaggggctggagagggccctcggggtgaagacg
aggatctactacaagtttgagggagtgctgccggtgggtagccacaagctcaacacagcg
gtggcgcaggcgtactacgcaaaggctgacggcgccgtggaggtggccacggagaccggg
gcggggcagtgggggatggccgtgtcgctggcggcggcgctcttcgggctgaaggccgtt
gtgtttatgacgaggtcctcctacaactccaagaggcagaggctgaccttcatgcgtaca
tacggcgccgtggtgtaccccagccccagcgaggtgaccgaggccgggaggaggcactac
aggcccgaccacccgggctctctgggcatagccatatccgaggctgtggagtacgtgctg
tctggcgagaggaggaggtacctgcctgggagcgtcatggagtttgtcttgatgcatcaa
acagtcatcgggctggaggccgtggagcaactgccggaggagccagacgtcgccgtggcg
tgtgtggggggcggctctaacttcgccggcttcacatacccaatgattgggatgaggctg
aggggggaggggtttgaaaagacgcggttcgtcgccgtggagtcggaggcggctcccaaa
ctcacgaggggggagtataaatacgactttccagatgccgtgggggtgctccccatgttg
aagatgtacaccctcggccacgactacgtgccgcccgccatccacgccgcggggctccgc
taccacggcgcggcgcccagcctctcgctactgaagaggctaggcatcgtggaacccctc
gcctatccccaagaggaggtgatgaaggcggccgtcctattcgccaggtcagagggcgtc
gtcccggcgcctgagtcggcccacgccatcagggcggttatcgacctggcgaagaagttg
ccggatggctctgtaatcgccttcaacctatcgggccacggccttctcgacgccgacgcg
tacgaaaagtttctagcataa

DBGET integrated database retrieval system