KEGG   Pyrobaculum ferrireducens: P186_1158Help
Entry
P186_1158         CDS       T01670                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P186_1158
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P186_1158
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P186_1158
Enzymes [BR:pyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P186_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
972918..973619
Genome map
AA seq 233 aa AA seqDB search
MLRRPGLGVYLVAGWPNREIYGRVVKELGGVVDFYELGVPTRNPKYDGPYIRKAHREVET
PTWLRPEVPTYAMAYWEDYRANPTKLFNLAAEVGARGVLTPDLLIDFHEDFDTYIKLCRE
FGLAPVFFVPGKFPHKLVERLAAAEPDFIYLGLYAATGIELPVYVERNVRIIRQLVGDVY
IVAGFAVDAPAKAARLVEAGADGVVVGTAFMRRLQKSPEEALAFLREIKVALR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcagacccggcctcggggtgtacctcgtcgcgggctggcccaacagagagatc
tacgggagggtggtgaaggagcttggcggcgttgtagacttctacgagctaggcgttccc
acccgaaaccccaagtatgacggcccctacatcagaaaggcccatagagaggtggagacc
cctacgtggctgaggcctgaggtgccgacctacgccatggcgtactgggaagactaccga
gccaaccccacgaagctcttcaacctggcggccgaggtgggcgccaggggggtgctgacc
cccgacctgctgatagacttccacgaggacttcgatacttacataaagctgtgcagagag
ttcggactcgccccggtgttcttcgtgccggggaagttcccgcacaaactggtggagagg
ctcgccgccgcggagcccgacttcatatacctcggcctctacgcagccacagggatcgag
ctccccgtctatgttgagaggaacgtcaggataatccgccagctggtgggcgacgtctac
atcgtggctggcttcgccgtggacgcccccgctaaggcggctaggcttgtggaggccggg
gcggacggcgttgttgtaggcacagccttcatgaggcgtttgcagaaaagcccagaggag
gccctggccttcctccgcgagatcaaggtagcgcttagatga

DBGET integrated database retrieval system