KEGG   Pyrobaculum ferrireducens: P186_1158Help
Entry
P186_1158         CDS       T01670                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00260  Glycine, serine and threonine metabolism
pyr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pyr01100  Metabolic pathways
pyr01110  Biosynthesis of secondary metabolites
pyr01130  Biosynthesis of antibiotics
pyr01230  Biosynthesis of amino acids
Module
pyr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P186_1158
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    P186_1158
Enzymes [BR:pyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     P186_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE IMPDH IGPS ThiG
Motif
Other DBs
NCBI-ProteinID: AET32591
UniProt: G7VCH1
Position
972918..973619
Genome map
AA seq 233 aa AA seqDB search
MLRRPGLGVYLVAGWPNREIYGRVVKELGGVVDFYELGVPTRNPKYDGPYIRKAHREVET
PTWLRPEVPTYAMAYWEDYRANPTKLFNLAAEVGARGVLTPDLLIDFHEDFDTYIKLCRE
FGLAPVFFVPGKFPHKLVERLAAAEPDFIYLGLYAATGIELPVYVERNVRIIRQLVGDVY
IVAGFAVDAPAKAARLVEAGADGVVVGTAFMRRLQKSPEEALAFLREIKVALR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcagacccggcctcggggtgtacctcgtcgcgggctggcccaacagagagatc
tacgggagggtggtgaaggagcttggcggcgttgtagacttctacgagctaggcgttccc
acccgaaaccccaagtatgacggcccctacatcagaaaggcccatagagaggtggagacc
cctacgtggctgaggcctgaggtgccgacctacgccatggcgtactgggaagactaccga
gccaaccccacgaagctcttcaacctggcggccgaggtgggcgccaggggggtgctgacc
cccgacctgctgatagacttccacgaggacttcgatacttacataaagctgtgcagagag
ttcggactcgccccggtgttcttcgtgccggggaagttcccgcacaaactggtggagagg
ctcgccgccgcggagcccgacttcatatacctcggcctctacgcagccacagggatcgag
ctccccgtctatgttgagaggaacgtcaggataatccgccagctggtgggcgacgtctac
atcgtggctggcttcgccgtggacgcccccgctaaggcggctaggcttgtggaggccggg
gcggacggcgttgttgtaggcacagccttcatgaggcgtttgcagaaaagcccagaggag
gccctggccttcctccgcgagatcaaggtagcgcttagatga

DBGET integrated database retrieval system