KEGG   Pyrobaculum ferrireducens: P186_1326Help
Entry
P186_1326         CDS       T01670                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00010  Glycolysis / Gluconeogenesis
pyr00020  Citrate cycle (TCA cycle)
pyr00620  Pyruvate metabolism
pyr00633  Nitrotoluene degradation
pyr00640  Propanoate metabolism
pyr00650  Butanoate metabolism
pyr00680  Methane metabolism
pyr00720  Carbon fixation pathways in prokaryotes
pyr01100  Metabolic pathways
pyr01120  Microbial metabolism in diverse environments
pyr01130  Biosynthesis of antibiotics
pyr01200  Carbon metabolism
Module
pyr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pyr_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1326
   00020 Citrate cycle (TCA cycle)
    P186_1326
   00620 Pyruvate metabolism
    P186_1326
   00640 Propanoate metabolism
    P186_1326
   00650 Butanoate metabolism
    P186_1326
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1326
   00680 Methane metabolism
    P186_1326
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    P186_1326
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     P186_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AET32755
UniProt: G7VDH0
Position
complement(1108624..1109160)
Genome map
AA seq 178 aa AA seqDB search
MREVIFLGRGGQGAVTAAQLLAYAASLEGKKAQALPEFGAERRGAIVRAYLRIGEALLHS
SVKKADYVVVLDGRIIEQVDVRQYGKPGAVYIVNIKSPSDWYISIDATSIALKHGLVVAG
WPVVNLIMAAAFAAVSGLVTLESIVKAVPEYVPRRYVEANIKAVVEGYELAKRLVEAR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtaatttttctcggccgcggggggcagggcgccgtcactgccgcccagctc
ttggcttacgccgcctctctagagggtaaaaaggcgcaggccttgcccgagtttggagcc
gagaggaggggggccatcgtgagggcttacctaaggataggagaggctcttctccactct
tcagtgaagaaggcggactacgtcgtggtgttagacggccgtattattgagcaggtagat
gttaggcagtacggcaagcccggcgctgtgtatatagtaaacatcaagtcgccgtcggat
tggtatatatctatcgacgcgacgtcgatcgcgcttaaacacggccttgtagtagcgggg
tggcccgtggtcaacctcataatggcggccgcgtttgcggcagttagcgggttggtgacg
ctggaaagcatcgtaaaagcggtgcctgaatacgtgccgaggaggtacgtagaggctaat
ataaaagccgtggttgagggatatgaattagcgaagagattagtagaagctcgctaa

DBGET integrated database retrieval system