KEGG   Pyrobaculum sp. 1860: P186_1328Help
Entry
P186_1328         CDS       T01670                                 

Definition
2-ketoacid ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_1328
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1328
   00020 Citrate cycle (TCA cycle)
    P186_1328
   00620 Pyruvate metabolism
    P186_1328
   00640 Propanoate metabolism
    P186_1328
   00650 Butanoate metabolism
    P186_1328
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1328
   00680 Methane metabolism
    P186_1328
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    P186_1328
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     P186_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109569..1110723
Genome map
AA seq 384 aa AA seqDB search
MKALVAQKTALTGNYAVAYAVKMAKPHVIAAYPITPQTSIVEKLSEFVERGELNARFVNV
ESEFAAMSVVYGAAMAGARAFTATSSHGLLYMYEATWWTALSRAPVVMAVVTRTIGPPWN
IHVEHNDILVLRDTGWLIAMAETVQEVLDLTIQAFRIAETAVLPTAVGLDGFILSHSTEP
VELPPQELVDKFLPPRRPDVPLLLRPGEAVTFGNLPSDNRDHARHKIATVYTAQREAKKI
VSQVDEEYGRLTGRRYGGLVEWYKAGDAKNVVVCMGAWCSDAKQAVESLRRRGISIGLMR
VRFIRPFPEEEVAKLDQYERVVVYDRDITPLGGVLGTEIKALLSRARVVNIVAGIAGVDF
DAQNFYETIQKALDGSYREVEFVV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctggtagcgcagaaaacagctcttaccggtaactacgccgtggcttacgcc
gtcaagatggcgaagccccatgtaatagcggcataccccatcaccccgcaaacgtccatc
gtagagaagctctccgagttcgtggagaggggggagttaaacgccagatttgtcaacgtg
gagtcggaattcgcggcgatgtcagtcgtctacggcgcggcgatggctggcgcgcgggcg
tttacagccacgtcctctcacgggttgctgtacatgtatgaggcgacttggtggaccgcc
ctcagcagggcgccggttgtcatggccgtcgtcacccgcaccatcggcccgccatggaat
atccacgtggagcacaacgacatactagtccttagagacacggggtggttgatagctatg
gcggagacggtgcaggaggtgctcgacttgacaatacaggcatttagaattgcggagact
gcggttctccccaccgcggtggggcttgacggctttatcctcagccattcaacggaaccc
gtcgagttgccgcctcaggaattggttgataaattcctgccgccccgcaggccggacgtg
ccgttgttgctacgtccgggcgaggctgttacattcggcaacctgccttcagacaataga
gatcacgcgaggcacaagatagcaaccgtgtacacggcgcagagggaggcgaagaagata
gtaagccaggtcgacgaggagtatggaaggctgactgggaggcgctacggggggcttgtc
gagtggtataaggcgggcgatgctaagaacgtcgttgtgtgtatgggggcttggtgtagc
gacgcgaagcaggccgtggagagcctcaggaggcggggcatctccattgggttaatgagg
gtgagattcataaggccgttccccgaggaggaggtggccaagctagatcagtacgaaaga
gttgttgtatacgatagagacataaccccgctggggggagtactggggactgagatcaag
gcgcttctctcaagggccagggtggtgaatatagtagctggcatagctggcgtcgacttc
gacgcccagaacttctacgaaactatacaaaaagccctagacggaagttacagagaagtg
gagtttgtagtatga

DBGET integrated database retrieval system