KEGG   Pyrobaculum sp. 1860: P186_1587Help
Entry
P186_1587         CDS       T01670                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P186_1587
Enzymes [BR:pyr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     P186_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1337460..1338365
Genome map
AA seq 301 aa AA seqDB search
MGRVKAVLGGLTVGDGEPLRIMAVLNLSPESFYKGSVAHADPVSRAAELEKHSDILDVGA
MSTAPYLETWIPPEKELERLRSVLPDLVAAVKIPISIDTYRPKVAEYALKTGAAAVNDVT
GGKLYPEMCRVVAGYGASVVLVARETHPRAGLEPVKRVVEALRESVERFEKCGVEREKIV
VDPGIGFPLLPPRDEPYVVRGEYRHGDPQWPWWKWDLHLIANLSALRELGRPILVGVSRK
SFLRKIAGVERAEEVLPASLAAETVAALNGAHVIRTHNPLETRQAVKVAEALRSINPPKE
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagtcaaggcggtgctgggagggctgactgtcggcgacggcgagcccctccgc
ataatggccgtgctcaacctctcacccgagtccttctacaaaggctccgtagcccacgcg
gatccggtgtcgagggccgccgagctggagaaacactccgacatcctagacgtgggagcc
atgtccaccgccccctacctagagacgtggatacccccagagaaggagctggagcggctc
agatctgtgttgcccgacctcgtcgccgccgtcaagataccaatcagcatagacacatac
cgccccaaggtggccgagtacgccctcaagaccggggccgccgccgtcaacgacgtgacg
ggaggcaagctctaccccgagatgtgcagagtcgtggcgggctacggcgcatccgtcgtc
ctcgttgccagggagacacacccacgggccggacttgaaccagtcaagagggtggtagaa
gccctgagggagtctgtggagcgttttgaaaaatgcggcgtggaaagggagaagatagtg
gtagaccccgggattggcttccccctgttgccccccagagacgagccctatgtggtgagg
ggcgagtacagacacggcgatccccagtggccgtggtggaagtgggatcttcacctcatc
gccaacctctccgcgcttagggagctgggcagacccatactggtgggcgtctccaggaaa
tccttcctaaggaagatagccggcgtcgagagggctgaagaggtgctcccagcatccctc
gccgccgagacggtggccgcgctcaacggcgcgcatgtaatcaggacccacaacccgctg
gagactagacaagccgtgaaggtggccgaggcgctcaggtcaataaacccccctaaggaa
gtctaa

DBGET integrated database retrieval system