KEGG   Pyrobaculum sp. 1860: P186_1638Help
Entry
P186_1638         CDS       T01670                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P186_1638
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P186_1638
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P186_1638
Enzymes [BR:pyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P186_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383988..1385082
Genome map
AA seq 364 aa AA seqDB search
MFAPNYRLYRCPKCGGLLEVEVSNLHWTPKGRGVWRYASMLPLKSGVSLGEGQTPLVKSV
LGEGLYVKFDGANPTGSFKDRGMALGVTVARESGANKVVVASTGNTAASAAAYAARAGLR
CYVVLPRGNVARGKLVQAALHGAELVMVNGYFDKALEYVVNYGTRYAYPLNSFNPWRLEG
QKTLAFEVYEELGCPDYVVVPVGNAGNISAIWKGFKELASLGLCNKLPKMIGVQAEGAAP
LADAWERGLEEPLFVDEPRTVASAIKIGRPINWPKALRAVRESGGFFVKVSDGEIIKAQR
LLATKDGLGAEPAGAASVAAALKLGLRGTVVAVVTGHALKDPDAVEVSAREVRNADELAE
LLER
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgcccccaactataggctatataggtgtcccaagtgcggcggccttctcgaagtg
gaggtgtctaacctacactggacccccaaggggaggggggtgtggcgctacgcctctatg
ctcccgcttaagagcggcgtgtcgctgggggagggccagacccctcttgtgaagtctgtc
ctgggggagggtctctatgtgaagttcgacggggctaacccgacgggtagctttaaggat
agggggatggcgctgggggtgaccgtggcgagggagagcggagcgaataaggtggtggtt
gcctccactggcaacactgcggcgtctgcggcggcttacgcggctagggctgggcttagg
tgctacgtggttctgccgagggggaacgtggcgaggggtaagctggtgcaggcggcgctt
cacggtgcggagctggtgatggttaatggctattttgacaaggcgctggagtacgtggtt
aactacggcactagatacgcctaccccctcaacagcttcaacccgtggaggctggagggg
cagaagaccctcgcttttgaggtatacgaggagctggggtgtccggactacgtggtggtg
ccggtgggcaacgccggcaacatatctgcaatctggaaggggtttaaggagctggcctcc
ctggggctgtgtaacaagcttccaaagatgatcggggtgcaggcggagggggcggcgccg
ctggcagatgcgtgggagagggggctggaggagcctctatttgtcgacgagccgaggacc
gtggcgtcggctatcaagatcgggcggcctatcaactggcctaaggctttgagggcggtg
agggagtccggcggctttttcgtaaaggtgtctgatggggagattatcaaggcgcagagg
ctcctggcgactaaggacggcctcggggcggagcccgccggggcggcctcggtagccgcc
gctcttaagctaggcctcagagggactgtggtcgccgtcgtcaccggacacgcgttgaag
gatcccgacgcggtggaggtatcggctagggaggttaggaacgccgacgagctcgcggag
cttttagagcgatga

DBGET integrated database retrieval system