KEGG   Pyrobaculum sp. 1860: P186_1638Help
Entry
P186_1638         CDS       T01670                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P186_1638
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P186_1638
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    P186_1638
Enzymes [BR:pyr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     P186_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383988..1385082
Genome map
AA seq 364 aa AA seqDB search
MFAPNYRLYRCPKCGGLLEVEVSNLHWTPKGRGVWRYASMLPLKSGVSLGEGQTPLVKSV
LGEGLYVKFDGANPTGSFKDRGMALGVTVARESGANKVVVASTGNTAASAAAYAARAGLR
CYVVLPRGNVARGKLVQAALHGAELVMVNGYFDKALEYVVNYGTRYAYPLNSFNPWRLEG
QKTLAFEVYEELGCPDYVVVPVGNAGNISAIWKGFKELASLGLCNKLPKMIGVQAEGAAP
LADAWERGLEEPLFVDEPRTVASAIKIGRPINWPKALRAVRESGGFFVKVSDGEIIKAQR
LLATKDGLGAEPAGAASVAAALKLGLRGTVVAVVTGHALKDPDAVEVSAREVRNADELAE
LLER
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgcccccaactataggctatataggtgtcccaagtgcggcggccttctcgaagtg
gaggtgtctaacctacactggacccccaaggggaggggggtgtggcgctacgcctctatg
ctcccgcttaagagcggcgtgtcgctgggggagggccagacccctcttgtgaagtctgtc
ctgggggagggtctctatgtgaagttcgacggggctaacccgacgggtagctttaaggat
agggggatggcgctgggggtgaccgtggcgagggagagcggagcgaataaggtggtggtt
gcctccactggcaacactgcggcgtctgcggcggcttacgcggctagggctgggcttagg
tgctacgtggttctgccgagggggaacgtggcgaggggtaagctggtgcaggcggcgctt
cacggtgcggagctggtgatggttaatggctattttgacaaggcgctggagtacgtggtt
aactacggcactagatacgcctaccccctcaacagcttcaacccgtggaggctggagggg
cagaagaccctcgcttttgaggtatacgaggagctggggtgtccggactacgtggtggtg
ccggtgggcaacgccggcaacatatctgcaatctggaaggggtttaaggagctggcctcc
ctggggctgtgtaacaagcttccaaagatgatcggggtgcaggcggagggggcggcgccg
ctggcagatgcgtgggagagggggctggaggagcctctatttgtcgacgagccgaggacc
gtggcgtcggctatcaagatcgggcggcctatcaactggcctaaggctttgagggcggtg
agggagtccggcggctttttcgtaaaggtgtctgatggggagattatcaaggcgcagagg
ctcctggcgactaaggacggcctcggggcggagcccgccggggcggcctcggtagccgcc
gctcttaagctaggcctcagagggactgtggtcgccgtcgtcaccggacacgcgttgaag
gatcccgacgcggtggaggtatcggctagggaggttaggaacgccgacgagctcgcggag
cttttagagcgatga

DBGET integrated database retrieval system