KEGG   Pyrobaculum sp. 1860: P186_1662Help
Entry
P186_1662         CDS       T01670                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_1662
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1662
   00620 Pyruvate metabolism
    P186_1662
   00640 Propanoate metabolism
    P186_1662
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1662
   00680 Methane metabolism
    P186_1662
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P186_1662
Lipid biosynthesis proteins [BR:pyr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P186_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402629..1404641
Genome map
AA seq 670 aa AA seqDB search
METKILEKEGELPFGENIINEKWRSRLTPVDAYYKFHAHTIENLETFWEGVAKELEWFKP
WDKVLDASNPPFYRWFVGGKLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDENGYPTDRRK
LTYYDLFREVNRVACMLKCNFGVKKGDRITLYMPMVPELPITMLAAWRIGAITSVVFSGF
SAEALAERINDSQSRIVITADGFWRRGKVVRLKEVVDTALEKATGVENVIVLPRLGLKDV
PMTEGRDYWWNRLMQGIAPNTYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHT
YATMKWVFDIRDDDIYWCTADIGWVTGHTYIVLGPLIMGATEIIYEGAPDYPQPDRWWAI
IERYGVTILYTSPTAIRMFMRYGEAWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGNE
KVAFGSTWWMTETGAIMISHAPGLYLVPMKPGTNGPPLPGIVADVYDDEGKPAPPGVKGY
LVIKKPWPGMLHGIWGDPERYVKTYWSRFPGVFYAGDYAIKDQDGYIWVLGRADEVIKVA
GHRLGTYELESALISHPTVAEAAVVGIPDAIKGEVPIAYVVLKQGVLPNDELRKELREHV
RKTIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKKAY
EELKAEVGRA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaagattttagaaaaagaaggcgagttgccctttggagaaaatataataaat
gaaaaatggagaagcagactcacccccgttgatgcttactataagtttcacgcccacaca
atagagaatttagagactttctgggagggagttgctaaggagctagagtggttcaagccg
tgggataaggtgcttgatgcctcaaatccgcctttctacaggtggttcgttggcggtaag
ctgaacctctcttaccttgccgtggatcggcacgtcaagacttggaggaagaataagcta
gctattgagtgggagggggagccggtggacgagaacggctaccccacagacaggaggaag
ctaacgtactacgacctcttcagggaggtgaaccgcgtcgcatgtatgttgaagtgcaac
ttcggggtcaagaagggggacaggattactctctacatgccgatggttccggagctcccc
ataacgatgctggcggcgtggagaatcggcgcgattacaagcgtcgtgttctccggcttc
tcggcggaggcgctggctgaacgcatcaacgactcacagtcccgcatagtcataaccgca
gacggcttctggaggaggggcaaggtggtgaggctgaaggaggtggtcgacacggctttg
gagaaggcgacgggggtggagaacgtaattgtgctcccgcgcctcggcctcaaggacgtg
ccgatgacagaggggagggactactggtggaaccgcttgatgcagggcatcgcaccgaac
acatacatagagccggagcctgtggaaagcgagcacccgtcctttatcctttacacatct
ggcaccaccggcaagcccaagggcattgtccacgacacgggcggctgggctgtacacaca
tacgcaacgatgaagtgggtcttcgacataagagacgacgatatttactggtgcacggca
gatataggctgggtcaccggccacacctacatagtgcttggcccgttaattatgggggca
actgaaatcatttatgagggagcgccagactacccgcagccggataggtggtgggcgata
attgagcgctatggggtgacaatactgtacacctcccccaccgccattaggatgtttatg
aggtatggagaggcgtggccgaggaaacacgacttgtctacgttgcgcataatccactcc
gtgggtgagcccattaacccagaggcgtggaggtgggcctacagagttctcggcaatgag
aaggttgcctttggctccacctggtggatgacagagacgggggctattatgatcagccac
gccccgggcctctacctagtgcccatgaagcccggcaccaacgggccgcccctccccggc
atcgtagccgatgtatacgacgacgagggcaagccggctccgcccggcgtcaagggctac
ctcgtgattaagaagccctggccggggatgctccacggcatctggggcgacccggagcgc
tatgtgaagacgtactggagccgcttccccggcgtgttctacgccggcgactacgccata
aaggatcaagacggctacatatgggtgttggggagggccgacgaggtgattaaagtcgcc
ggccacaggctgggcacctacgagctggagtcggcgctcatatcgcaccccacagtggcg
gaggcggcggtggtgggtatacccgacgccatcaagggtgaggtgcccatcgcctacgtg
gtgttgaagcagggggtgttgcctaacgacgagttgaggaaggagctgagggagcacgtc
cgcaagaccatcggcccaatcgccgagccggcccagatattcttcgtcaccaagttgccc
aagacccgctccggcaagatcatgcgccgcctattgaaggcggtggccacaggggcgccc
ctcggcgacgtaaccacgctggaggatgagacgtcagtggaagaggctaaaaaggcgtac
gaggagctgaaggcagaggttgggagggcatga

DBGET integrated database retrieval system