KEGG   Pyrobaculum sp. 1860: P186_1662Help
Entry
P186_1662         CDS       T01670                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_1662
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1662
   00620 Pyruvate metabolism
    P186_1662
   00640 Propanoate metabolism
    P186_1662
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1662
   00680 Methane metabolism
    P186_1662
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P186_1662
Lipid biosynthesis proteins [BR:pyr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P186_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402629..1404641
Genome map
AA seq 670 aa AA seqDB search
METKILEKEGELPFGENIINEKWRSRLTPVDAYYKFHAHTIENLETFWEGVAKELEWFKP
WDKVLDASNPPFYRWFVGGKLNLSYLAVDRHVKTWRKNKLAIEWEGEPVDENGYPTDRRK
LTYYDLFREVNRVACMLKCNFGVKKGDRITLYMPMVPELPITMLAAWRIGAITSVVFSGF
SAEALAERINDSQSRIVITADGFWRRGKVVRLKEVVDTALEKATGVENVIVLPRLGLKDV
PMTEGRDYWWNRLMQGIAPNTYIEPEPVESEHPSFILYTSGTTGKPKGIVHDTGGWAVHT
YATMKWVFDIRDDDIYWCTADIGWVTGHTYIVLGPLIMGATEIIYEGAPDYPQPDRWWAI
IERYGVTILYTSPTAIRMFMRYGEAWPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGNE
KVAFGSTWWMTETGAIMISHAPGLYLVPMKPGTNGPPLPGIVADVYDDEGKPAPPGVKGY
LVIKKPWPGMLHGIWGDPERYVKTYWSRFPGVFYAGDYAIKDQDGYIWVLGRADEVIKVA
GHRLGTYELESALISHPTVAEAAVVGIPDAIKGEVPIAYVVLKQGVLPNDELRKELREHV
RKTIGPIAEPAQIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKKAY
EELKAEVGRA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaagattttagaaaaagaaggcgagttgccctttggagaaaatataataaat
gaaaaatggagaagcagactcacccccgttgatgcttactataagtttcacgcccacaca
atagagaatttagagactttctgggagggagttgctaaggagctagagtggttcaagccg
tgggataaggtgcttgatgcctcaaatccgcctttctacaggtggttcgttggcggtaag
ctgaacctctcttaccttgccgtggatcggcacgtcaagacttggaggaagaataagcta
gctattgagtgggagggggagccggtggacgagaacggctaccccacagacaggaggaag
ctaacgtactacgacctcttcagggaggtgaaccgcgtcgcatgtatgttgaagtgcaac
ttcggggtcaagaagggggacaggattactctctacatgccgatggttccggagctcccc
ataacgatgctggcggcgtggagaatcggcgcgattacaagcgtcgtgttctccggcttc
tcggcggaggcgctggctgaacgcatcaacgactcacagtcccgcatagtcataaccgca
gacggcttctggaggaggggcaaggtggtgaggctgaaggaggtggtcgacacggctttg
gagaaggcgacgggggtggagaacgtaattgtgctcccgcgcctcggcctcaaggacgtg
ccgatgacagaggggagggactactggtggaaccgcttgatgcagggcatcgcaccgaac
acatacatagagccggagcctgtggaaagcgagcacccgtcctttatcctttacacatct
ggcaccaccggcaagcccaagggcattgtccacgacacgggcggctgggctgtacacaca
tacgcaacgatgaagtgggtcttcgacataagagacgacgatatttactggtgcacggca
gatataggctgggtcaccggccacacctacatagtgcttggcccgttaattatgggggca
actgaaatcatttatgagggagcgccagactacccgcagccggataggtggtgggcgata
attgagcgctatggggtgacaatactgtacacctcccccaccgccattaggatgtttatg
aggtatggagaggcgtggccgaggaaacacgacttgtctacgttgcgcataatccactcc
gtgggtgagcccattaacccagaggcgtggaggtgggcctacagagttctcggcaatgag
aaggttgcctttggctccacctggtggatgacagagacgggggctattatgatcagccac
gccccgggcctctacctagtgcccatgaagcccggcaccaacgggccgcccctccccggc
atcgtagccgatgtatacgacgacgagggcaagccggctccgcccggcgtcaagggctac
ctcgtgattaagaagccctggccggggatgctccacggcatctggggcgacccggagcgc
tatgtgaagacgtactggagccgcttccccggcgtgttctacgccggcgactacgccata
aaggatcaagacggctacatatgggtgttggggagggccgacgaggtgattaaagtcgcc
ggccacaggctgggcacctacgagctggagtcggcgctcatatcgcaccccacagtggcg
gaggcggcggtggtgggtatacccgacgccatcaagggtgaggtgcccatcgcctacgtg
gtgttgaagcagggggtgttgcctaacgacgagttgaggaaggagctgagggagcacgtc
cgcaagaccatcggcccaatcgccgagccggcccagatattcttcgtcaccaagttgccc
aagacccgctccggcaagatcatgcgccgcctattgaaggcggtggccacaggggcgccc
ctcggcgacgtaaccacgctggaggatgagacgtcagtggaagaggctaaaaaggcgtac
gaggagctgaaggcagaggttgggagggcatga

DBGET integrated database retrieval system