KEGG   Pyrobaculum sp. 1860: P186_1664Help
Entry
P186_1664         CDS       T01670                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_1664
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1664
   00620 Pyruvate metabolism
    P186_1664
   00640 Propanoate metabolism
    P186_1664
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_1664
   00680 Methane metabolism
    P186_1664
Enzymes [BR:pyr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     P186_1664
Lipid biosynthesis proteins [BR:pyr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   P186_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1406748..1408703
Genome map
AA seq 651 aa AA seqDB search
MEHVYSKYSVYKRWLEDQEGYWREFLEKTSNLIYWAKKPDQIFEWNPPQPFRWFTGGYTN
AGYSAVDYKVGRFGDKTAYIYVNPELGLERRVTYGELYNLVCRFSAAMRAAGVGRGDSVL
IYMPNTVEAVAAILAAARIGAVSSTVFAGFSPKAVADRVELVEPKIIFTQDYSVRRGRRV
PLKENIDEALKISPWRPRMVVVRRSLMEEKEPPMDRGRDMWLEEFLEMGKAGDCSPLFVE
SNEPLFVLPTSGTTAKPKPVVHVHGGYQVWIIHGALLVYGLSSDDVIFNTSDIGWVVGQS
YIVFAPTILGATSVLFDGVIDHPRPDVFWEVVEKYRPTLIWTSPTAARMLMRLGAHHARR
HDLSSVKRVVTAGEVLNPEVWRWLYEEAFQKRVPVIDHWWQTELSGPAIGYYHALVKDMP
QGLEFMQIKPGSAGVPIPGVEVEVVDEKGNPLPPGQKGTLVIKKPFPGMTPTLWKDHRRY
MADYWERFEGKTVYYTGDAAYVDEDGYVWFGGRADEVIKIAGHRIGTIEVESALLTHPAV
AEAAVVGVPDPIRGEAIAAFVVLRPGWSPSEALRRELIEHVRKTFGPIAVFAGMEFVNML
PRTRSGKIMRRVMKRLWTGEPLGDLSTIEDEASVDEVREAVSRLKVLKIEE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgtatatagtaaatacagtgtatataaaagatggttagaagatcaagaggga
tactggagagagtttctagagaagacctctaacttgatatactgggcaaagaagccagat
cagatatttgagtggaatccgccccagccgtttagatggttcactggaggctacaccaat
gccggctacagcgccgtggattacaaagtgggtagattcggcgacaagactgcatatatc
tacgtaaaccccgagcttggtctagagaggagggtaacctacggcgagctgtacaaccta
gtgtgtagattcagcgcggccatgagggcggcgggggtggggaggggggactccgtcctt
atctacatgccaaacaccgtggaggcggtggcggctattctggcggcggctaggataggg
gcggtgtccagcacggtgttcgccggcttctcgcctaaggccgtggcggacagggtcgag
cttgtggagcccaagattatctttacacaagactactctgtgaggagggggcggagggtt
ccgctgaaggagaatatagacgaggcgctgaagatatcgccgtggaggccccgtatggtg
gtggtgaggaggagcctaatggaggagaaggagccgcccatggataggggccgcgacatg
tggctggaggagtttctcgaaatggggaaggccggcgactgctcgcctctgtttgtagag
tctaacgagcctctattcgtcctgccgacgtcgggcaccaccgccaaaccaaagccggtt
gtccacgtccacggcggctaccaggtgtggattatccacggcgccttgctcgtatacggc
ctgtccagcgacgacgtgatattcaacacaagcgacataggctgggtggtggggcagagc
tacatagtcttcgcccctaccatattgggcgcgacctcagtcttattcgacggcgtcata
gaccaccccaggccagacgtgttttgggaggtggttgagaagtaccgccccaccttgata
tggacctcgcccacggccgccaggatgttgatgaggctgggggcccaccacgccaggagg
cacgacctctccagcgtcaagcgggttgtgaccgccggcgaggtgcttaacccagaggtg
tggaggtggctgtatgaggaggccttccagaagcgggtcccagtaattgaccactggtgg
cagaccgagctcagcggccccgccatcggctactaccacgcccttgtgaaagacatgccc
caaggcctggagtttatgcaaatcaagccgggctccgccggcgtgccgatccccggcgtg
gaggtggaggtggtggacgagaagggcaacccactaccgcccgggcagaaaggcaccttg
gtaataaagaagccgttccccggaatgacccccactctgtggaaagatcacaggaggtat
atggccgactactgggagcgctttgaggggaagacggtttactacaccggcgacgccgcg
tatgtagacgaggacggctacgtgtggttcggcgggagggcagacgaggtgataaaaatc
gccgggcaccgcataggaacaatagaggtggaatccgccctcctcacgcaccccgccgtg
gccgaggcggctgtggtcggcgtgcccgacccaataaggggagaggcgatcgccgccttc
gtcgtgctccgcccaggctggagccccagcgaggctttgagaagggagttgatagaacat
gtgaggaagaccttcggccccatcgcggtgttcgccggcatggagttcgtcaatatgctt
cccagaactcggtctggaaaaatcatgcgtagagttatgaagcggctctggaccggggag
ccgctcggcgacttgtctacaatagaagacgaggcgtctgtagacgaggtgagagaggct
gtgtcgaggctaaaagttctgaaaatagaagagtaa

DBGET integrated database retrieval system