KEGG   Pyrobaculum sp. 1860: P186_1703Help
Entry
P186_1703         CDS       T01670                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pyr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1445564..1446238)
Genome map
AA seq 224 aa AA seqDB search
MEREKVPEVEALGAVAEVVKILRVFNPMEMVNCADVYIGLLEAKMRGFSRVCTGDGGDDL
CIGYDFMLRKGVDELASYLRQMRGRWYFCSFDIGKALGVSVKAPFLEIEEFLMSIPLEEK
IRCGVGKCLLRLELEKALGGLGRRRKDPIEVGSGFRKLYDVLAALGRDVDVDIPVKGAAR
YLYHLFRNMGLSYARGGARPCPVCGAETDGRYCRMCGWYISNTG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggagagagaaaaggtgccggaggtcgaggcgctgggggcggttgccgaggttgtgaaa
attctccgggtgtttaaccccatggagatggttaactgcgccgatgtttacatcggcctc
ctggaggctaagatgcgcggcttttctagagtctgtacgggggacggcggggatgacctc
tgcatcggctacgactttatgttgagaaagggagttgacgagctggcgagctatctacgc
caaatgcggggccggtggtatttctgtagttttgacatcgggaaggccctgggcgtctct
gtaaaagccccgtttctcgagatagaggagttcctcatgtcaatccctcttgaggagaag
ataaggtgtggagttgggaagtgcctactgcgccttgagcttgagaaggcgctcggcggg
ctggggcgcaggaggaaagaccctattgaggtgggtagcggctttcgaaagctctacgac
gtactagctgcgctgggcagagatgtcgatgtagatatcccggtaaaaggcgccgcgagg
tatctctaccacctgttccgcaacatgggcttgtcctatgcgcgcggaggtgcaaggccg
tgtcctgtatgcggcgcagaaaccgatgggaggtactgcaggatgtgtggctggtatatc
agcaacacggggtag

DBGET integrated database retrieval system