KEGG   Pyrobaculum sp. 1860: P186_1853Help
Entry
P186_1853         CDS       T01670                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_1853
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_1853
   00020 Citrate cycle (TCA cycle)
    P186_1853
   00620 Pyruvate metabolism
    P186_1853
Enzymes [BR:pyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P186_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561143..1562333
Genome map
AA seq 396 aa AA seqDB search
MEFKFPDLGEGLVEGEVVKWHVKEGDYVKEGDPLVDVMTEKATVTLPAPTSGKVVKILAR
EGQVVKVGQTLCIIEPAAEAAPPEKPQAAQPAPREVAAMPAARRLARELGIDLTKVRGTG
PGGVITVEDVRRYAEELKGREAETPKPAEAPKAVEVSKPPEAPRAAEAEVIPVRGVRRAV
AEKMTKAKRLIPHAYHLEEVDFTELLRLRERLKAEAERRGVRLTVLPFIVKAVAQALREF
PMLNSEYDEEKNVIVVKKEVNIGVGVDTEHGLVVVVVRDADKKSVLELAREIGALADKAR
AGKLDIQDVRGSTFTISNIGAVGGLGGLSILNYPEAAIMAVGQARKKPWVVGDRIEIRDI
ALVAVSFDHRVVDGAYVARFTSRVKELLERPEALLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaaattcccagacctgggcgaaggccttgtagaaggcgaggtggttaagtgg
cacgtcaaggagggggactacgtcaaggagggcgaccccctagtcgacgtcatgactgag
aaggcgacggtgaccctcccggcgcccaccagcggcaaggtcgtaaagatactggcgagg
gagggacaagtggttaaggttggccaaaccctctgcataatcgagccggcggcggaggcg
gcgcctcccgagaagccccaggcggcccagccggccccccgcgaggtggcggcgatgccg
gccgcccgcaggctggctagggagctgggcatcgacctcacaaaggtgagaggcaccggg
ccaggcggcgtgatcaccgtggaggacgtgaggagatacgccgaggagctaaagggcagg
gaggcggagacgcctaaacccgcagaggctccgaaggctgtggaggtctccaagcccccg
gaggccccgagggcggccgaggcggaggttataccggttagaggggtgaggagggccgtc
gccgagaagatgacgaaggccaagaggctgatcccccacgcataccacctcgaggaggtg
gactttacagagttgctgagactgcgcgagaggctgaaggccgaggcggagaggaggggc
gtgcggctaacagtactgcctttcatagtcaaggcggtggcgcaggcgcttagggagttc
ccaatgctgaactcagagtacgacgaggagaagaatgtgattgtggttaagaaggaggtg
aatatcggcgttggtgtggacacggagcacggccttgtggtggtcgtcgtgagagatgcc
gataagaagagcgtcttggagctggctagggagataggggctctggcggacaaggcgagg
gccggcaagctggatatacaagacgtgaggggctctaccttcaccatcagcaacatcggc
gccgtcggggggctgggcggcctctccatactgaactaccccgaggccgccatcatggca
gtcggccaggccaggaagaagccgtgggtcgtgggggataggatagagataagagacatt
gccctggtggctgtcagcttcgaccacagagtggtggacggggcctacgtggctaggttc
accagcagagtgaaggagctcctcgagaggccggaggctctactgctatga

DBGET integrated database retrieval system