KEGG   Pyrobaculum sp. 1860: P186_2141Help
Entry
P186_2141         CDS       T01670                                 

Definition
aldehyde ferredoxin oxidoreductase (aor)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2141
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P186_2141
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     P186_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1781777..1783624
Genome map
AA seq 615 aa AA seqDB search
MAVFKVLRVDLSTEKISEEVYKEDIIRKFLGGRGLGAYLALKELPRGIDPFSPSNKLYIF
AGPLSGTANLATSRINVVGKSPLTGSYTHSNAGGNFAYWLRRSGYDGIIVEGKADEPVYI
LVKDGEVTIRPAKHIWGKWTGAATKALLTDAGFEPDEKKAGVMTIGPAGEDLVRIAGLRF
SDYERFAGRGGLGAVAGAKKLKGIVVWGTHDPMKEFVDRQRFLKVATEYSVKLMNAATSK
ALHQYGTNLLTNIINSIGGYPTRNFETGYFEEAEKISGEYIKQNYVKEVHGCMLCPIQCT
QITVVASGPYKVAGEKIKYEYESTWALGANLGLSQTDAVLKLEKLANELGMDSISLGNTL
GTFLELVKRGKIQYDISWGDAASLIDLVYKMAYRIDIGDDLAEGDWRLANKYGAPDAFVG
SRGQGFPAYDPRALKGFAISYVTANRGGDHLEAYSPTWEVLGVPEKIDPLCETPECISKQ
VRLVIYAQHLMALADSVTYCKFDTLDKDGIFETHISDLFNAAFGWDTTPQEMLTIGERIF
NVERLFHVKEGKWVKDELPPKMREPIKTGPAQGHTASKMFDEGIKEFYKLRGWVDGKPTY
ETLKRLGLEEFQYLL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtttaaagttctgcgagtagatctatccacggagaaaattagcgaagaggta
tacaaggaggatattattagaaagtttctggggggtaggggcctgggggcatatctcgca
ttgaaggagttaccaaggggcattgacccattctccccctcaaataagctgtacatattc
gcgggtccgctgtcaggcaccgcgaacttagccactagtagaatcaacgtcgtcggaaag
agcccgctgacgggttcatatacgcattccaacgccggcgggaacttcgcctactggctg
aggaggagcgggtatgatggcataattgtggagggtaaggccgacgagcctgtctacata
ttagtgaaagatggcgaagtcacaataaggcctgcaaagcatatctgggggaagtggacc
ggagccgccacaaaggcgttgttaaccgacgctgggtttgagcctgatgagaagaaggca
ggcgtaatgactattggaccagctggcgaggaccttgtgaggatcgccggtttgaggttc
agcgactacgagaggttcgccggccgcggcgggctgggcgccgtggctggtgcgaaaaag
ttgaagggcatagtggtatgggggactcacgacccgatgaaggagtttgtggataggcag
aggtttctaaaggtggccactgagtactctgtaaagttgatgaatgccgccacgtccaag
gcgttgcatcagtacggaactaatctgcttaccaacataatcaactccattggggggtac
cccactaggaatttcgagacggggtacttcgaggaggcggagaagataagcggcgagtat
atcaagcagaactacgtcaaggaggttcacggctgtatgctgtgtccaatacagtgcact
cagataactgtggtagcctcaggtccttacaaggtggctggggagaagattaagtacgag
tacgaatctacctgggctctcggagccaacctcgggctctctcagaccgacgccgtgctg
aaactagagaagctagctaacgaacttggaatggactccatatctctggggaacaccttg
ggcacgttcctagagcttgtgaagaggggtaagatacagtatgatataagttggggcgac
gccgcttccctcatcgacttggtatataaaatggcgtataggatagatataggtgacgac
ttggccgagggcgactggaggctggctaataaatacggcgcaccagacgccttcgttggg
tcgagggggcagggcttccctgcgtatgaccccagggcgctgaaggggttcgctatttcc
tacgtgacggctaaccgcggcggggaccacctagaggcctacagcccgacgtgggaggtg
ctgggggtgcccgagaagatagatccgctgtgcgagacgccggagtgcatatcgaagcag
gttaggctcgttatatacgcacaacacttgatggctctcgccgactcggtgacctattgc
aagttcgacacgctggacaaggacggcatcttcgagactcacatatctgacttattcaac
gcggcttttggctgggacacgacgccgcaggaaatgttgacaataggcgagcgcattttc
aacgtcgagaggctgttccacgtgaaggagggcaagtgggtgaaggacgagttgcctccc
aagatgagagagcctataaagaccggccccgcccagggccacacggcgtctaagatgttt
gacgaggggattaaggagttctacaagctcagggggtgggtcgacgggaagccaacttac
gagactttgaagaggcttggcctagaggagttccagtacctgttgtaa

DBGET integrated database retrieval system