KEGG   Pyrobaculum ferrireducens: P186_2205Help
Entry
P186_2205         CDS       T01670                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pyr  Pyrobaculum ferrireducens
Brite
Enzymes [BR:pyr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     P186_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1833985..1834611
Genome map
AA seq 208 aa AA seqDB search
MAQRLVEELERDGIVRSERVKKALVAVPREEFVMPEYRMMAYEDRPLPLFAGATISAPHM
VAMMCELVEPRPGMKILEVGTGSGYHAAVCAEAIERRGRVYTVEIVKELAVYAAQNIERL
GYWGVVEVYHGDGTKGLEKHSPFDAIIVTAAASSIPPALVRQLKDGGVLVIPVEERLGQV
LYKVVKRGDRVERRAVTYVMFVPLKGGD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagacttgtggaggagttggagcgcgacggtattgtacggagtgagcgagta
aagaaggcgctggtagcggtgccccgggaggagttcgtcatgcctgagtaccgaatgatg
gcctacgaggacagacccctgccgctgttcgcaggcgccactatctcggcgcctcatatg
gtcgccatgatgtgcgagctggtggagcctaggcccgggatgaagatcttggaggtgggg
accgggtcggggtaccacgccgccgtatgcgccgaggctattgagaggaggggaagggtc
tacacggtggagattgtgaaagagctggcagtatacgccgcgcagaacatcgagaggctg
ggctactggggcgtggtggaagtttaccacggagatgggacgaaaggtcttgagaagcat
tccccgtttgacgccataattgtaacggccgccgccagctccatacccccggcgctggtg
aggcagttaaaagacggcggtgttttggtgatacccgtggaggagcggctgggccaggtg
ctgtataaggtggtgaaaaggggagatagagtggagaggcgggccgtgacttatgtaatg
tttgtccctcttaaaggcggcgactag

DBGET integrated database retrieval system