KEGG   Pyrobaculum sp. 1860: P186_2257Help
Entry
P186_2257         CDS       T01670                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pyr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pyr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876005..1876922
Genome map
AA seq 305 aa AA seqDB search
MWRRRDVVSARDFDRRDLEDLFETAKYMEKYAKSRVEFLKGRVMAVAFFEPSTRTRLSFE
TAMKRLGGEVVGFWGAEGTSVEKGETLADTVRMLDAYSDLIVIRHRYEGAAKLAAEVAEN
PVVNGGDGASNHPTQAMLDLYTIWREFGYIDGLNIGVVGDLRHARTVNSLLEALTNFNVK
VFLISPEYLRPRTETVDYIRSRGLRHSFHTSLEEVLRELDVLYVVRIQKERFLDPLEYER
VRGSYRISLDMLKNAKRHLAILHPLPRVDEIDHKVDSTPHAKYFKQAALGVPLRMALIYL
ILMGP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaggagagacgtcgtttcagcccgcgattttgacaggcgagatctcgaggat
ctgtttgaaactgctaagtacatggagaagtatgcaaagagccgcgtcgagttcctaaag
ggcagagtaatggctgtggcctttttcgaaccctctacgcggactaggcttagtttcgaa
accgccatgaagaggctcggcggggaggtggtgggcttctggggcgccgagggcacaagc
gtagagaagggagagactcttgcagacaccgtcagaatgctggatgcgtactccgacctc
atagttattagacataggtatgagggcgcggcaaagctagcagccgaggttgcagaaaac
cccgtcgtcaacggcggcgacggggcctccaaccaccccacacaggcaatgctagatctc
tacaccatctggagagaattcggctacatagacgggctgaatataggcgtcgtaggcgat
ctgcgccacgcgaggactgtaaacagcctcctcgaggcacttacaaattttaatgtaaag
gtgttcctaatttcgccggagtatctacgccctaggacggagactgttgactacatacgc
tcaagaggtttaagacacagcttccataccagtttagaagaggtgttacgtgaactcgac
gtgctgtacgtggtgaggatacaaaaggagaggtttctagacccgctagagtacgagagg
gtgaggggtagctacaggatttccctagatatgttgaaaaacgccaagaggcacttggct
atcctacacccacttccacgagttgacgaaattgaccacaaggtagactcgaccccccac
gccaaatacttcaaacaggcggcgctcggcgtgcccctgagaatggctcttatataccta
atccttatggggccatga

DBGET integrated database retrieval system