KEGG   Pyrobaculum sp. 1860: P186_2257Help
Entry
P186_2257         CDS       T01670                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    P186_2257
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P186_2257
Enzymes [BR:pyr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     P186_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1876005..1876922
Genome map
AA seq 305 aa AA seqDB search
MWRRRDVVSARDFDRRDLEDLFETAKYMEKYAKSRVEFLKGRVMAVAFFEPSTRTRLSFE
TAMKRLGGEVVGFWGAEGTSVEKGETLADTVRMLDAYSDLIVIRHRYEGAAKLAAEVAEN
PVVNGGDGASNHPTQAMLDLYTIWREFGYIDGLNIGVVGDLRHARTVNSLLEALTNFNVK
VFLISPEYLRPRTETVDYIRSRGLRHSFHTSLEEVLRELDVLYVVRIQKERFLDPLEYER
VRGSYRISLDMLKNAKRHLAILHPLPRVDEIDHKVDSTPHAKYFKQAALGVPLRMALIYL
ILMGP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggaggagagacgtcgtttcagcccgcgattttgacaggcgagatctcgaggat
ctgtttgaaactgctaagtacatggagaagtatgcaaagagccgcgtcgagttcctaaag
ggcagagtaatggctgtggcctttttcgaaccctctacgcggactaggcttagtttcgaa
accgccatgaagaggctcggcggggaggtggtgggcttctggggcgccgagggcacaagc
gtagagaagggagagactcttgcagacaccgtcagaatgctggatgcgtactccgacctc
atagttattagacataggtatgagggcgcggcaaagctagcagccgaggttgcagaaaac
cccgtcgtcaacggcggcgacggggcctccaaccaccccacacaggcaatgctagatctc
tacaccatctggagagaattcggctacatagacgggctgaatataggcgtcgtaggcgat
ctgcgccacgcgaggactgtaaacagcctcctcgaggcacttacaaattttaatgtaaag
gtgttcctaatttcgccggagtatctacgccctaggacggagactgttgactacatacgc
tcaagaggtttaagacacagcttccataccagtttagaagaggtgttacgtgaactcgac
gtgctgtacgtggtgaggatacaaaaggagaggtttctagacccgctagagtacgagagg
gtgaggggtagctacaggatttccctagatatgttgaaaaacgccaagaggcacttggct
atcctacacccacttccacgagttgacgaaattgaccacaaggtagactcgaccccccac
gccaaatacttcaaacaggcggcgctcggcgtgcccctgagaatggctcttatataccta
atccttatggggccatga

DBGET integrated database retrieval system