KEGG   Pyrobaculum sp. 1860: P186_2311Help
Entry
P186_2311         CDS       T01670                                 

Definition
sugar kinase, possible phosphofructokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P186_2311
Enzymes [BR:pyr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P186_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930305..1931222
Genome map
AA seq 305 aa AA seqDB search
MVVASIGNLNFDLYLRISELPGPDENVEALDLYTGGGGSAANFAVAVARMGLGARFIGAV
GDDPLGEISLRELRSEGVDVTFVKRVRGMRSGVVVVLVHPDGVKRMLSHRGANLGLTPAD
LTVDKFSGVRHIHLATGRTELILRAKEIAREIGATVSVDGGTALARKGLEIVKAAVEGVD
VVFMNHVEAKLLANTGDHKSAIERLARELRAGELVITLGPIGAVAFKEGKLLQVDAFKVN
AVDTTGAGDSFAAAYIAMYLEGRDLYEKLLFANAAAAIKVTRPGARSSPRRDEVVSFLES
FGYKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttgcgtctattggaaacctgaacttcgacctctacctcaggatatcggagcta
ccgggccccgacgaaaacgtcgaggctcttgacctgtacaccgggggcggggggtcggcc
gccaatttcgccgtggcggtcgccaggatggggctgggggcgaggtttataggcgcagtc
ggcgacgatcccctcggcgagatatctctgagagagctgaggtctgagggggtcgatgtt
acgtttgtaaagagggttagggggatgaggtcgggcgtcgtggtggtgctggtgcaccca
gacggggtgaagagaatgctgtcacacagaggggccaacctgggcctcaccccagcggac
ttaaccgtggacaagttttccggagtccggcacattcacctagccacggggaggaccgag
ctgattttaagagctaaggagatcgccagggagataggcgccacggtgtcggttgacgga
ggcacggccctcgccaggaaggggcttgaaattgtgaaggcggcggtggagggagtcgac
gtggtcttcatgaaccacgtagaggccaagctcctggcgaacaccggggaccacaaatcc
gcaatagagaggctggcgagggagctgagggctggggagctggtgataaccctgggcccc
ataggggccgtggctttcaaagaggggaagctcctccaagtagacgcctttaaggtaaac
gccgtcgacacgacgggcgcgggggacagcttcgcggccgcctacatcgccatgtatcta
gaggggagggatttatacgagaagcttctcttcgccaacgccgccgccgcgataaaagtg
acgcggccgggcgccaggtcctcaccccgccgcgacgaggtggtttcgtttctggagtct
tttggatacaagatttaa

DBGET integrated database retrieval system