KEGG   Pyrobaculum sp. 1860: P186_2371Help
Entry
P186_2371         CDS       T01670                                 

Definition
radical SAM protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pyr  Pyrobaculum sp. 1860
Brite
Enzymes [BR:pyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     P186_2371
Transfer RNA biogenesis [BR:pyr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    P186_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1977668..1979104
Genome map
AA seq 478 aa AA seqDB search
MFCCVVVVEELERPLRFIRMASGVHVVALMTEPFPCPGRCTFCPSAEGVPKSYMPDSPVV
LRAKRSRYDPYLQTAGRIKVYLMNGHLPSKIEAVVMGGTFGALPRWYREWFVANVFKALN
DYPNWAGSADPAPDLEAEQLRNESAAMRLVAITVETRPDFVDAGEVDFLLRLGVTRVELG
VQSIYDDVLARVGRGHGAAEVVRATALLKDSAYKVCYHLMPGLPGSDPDRDLEMVREVFS
NPDFMPDCVKIYPTYVVPGTALYEEWRRGAYRSYDEETWLDLLARIYAAVPRWARVMRLG
RDIPLHHVVDGPRWGNMRQVVLRHMERLGLRCVEIRCREAGVKLANGLPIQPGPVEVRRV
EYVASGGVEVFLEAVGPDDTLYGILRLRIPHGPHRPELRGAALVRELHVYGPEVPVGAEG
GWWQHRGIGRSLMERAEEIAAEFAKRVAVISGVGARPYFRKLGYERCGPYMCKELSAS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgttttgttgtgttgtggttgtggaggagctggagaggcctctgcgctttattaggatg
gcgagcggcgtgcatgtagtggctctgatgacagagccgtttccgtgtccgggccggtgt
accttctgcccgtcggcggagggggttcccaagtcctacatgcccgacagcccggtggtt
ctccgtgccaagaggagccgatacgatccctatctgcagaccgctggccgtatcaaagtg
tatcttatgaacggccacctcccgtcgaagatcgaggctgtggtgatggggggcaccttc
ggcgccttgccgcggtggtaccgggagtggtttgtggctaacgtcttcaaggcgctgaac
gactaccccaactgggcgggctcggcggatccggcgccggatttggaggccgagcagctt
aggaacgagtcggcggctatgcgcctcgtcgcgatcacggtggagacgcggcccgacttc
gtggacgcgggagaggtggacttcctactgaggctgggagtgactagggttgagctgggc
gtccagtctatatacgacgacgtacttgcgagggttgggaggggccacggcgccgccgag
gtggttagggcgacggctcttttgaaggattcggcttacaaggtctgctaccacctgatg
ccgggcctgccggggagcgatccagaccgcgacttggagatggtgagggaggtgttttca
aacccggacttcatgccggactgcgtcaagatataccccacgtacgtggtgccggggact
gcgttgtacgaggagtggcgccgcggggcgtaccgaagctacgacgaggagacttggctt
gacctcctggcgaggatatacgcggcggtgcccagatgggccagggtcatgcgcctcggc
cgcgacatccctctgcaccacgttgtggacggccccaggtgggggaacatgaggcaggtg
gtgctccggcatatggagaggcttgggctgaggtgtgtggagatccgctgtagggaggcc
ggcgtgaagctggccaacggcctgccgattcagcccggcccggtggaggttaggcgcgtc
gagtacgtggcgtcggggggcgtggaggtttttctagaggcggtggggcccgacgacact
ctctacgggattctgcggctgaggatcccccacggcccccacaggcccgagctccggggg
gcggccttggttagagagctccacgtctacggccccgaggtgcccgtcggcgcggagggg
ggctggtggcagcacagaggtataggcaggtctttgatggagagggcggaggagatcgcc
gcggagttcgcgaagagggtggctgtgatcagcggcgtcggcgcgaggccctacttccgc
aagctggggtacgagaggtgcggtccatatatgtgtaaagagctctcagcctcgtag

DBGET integrated database retrieval system