KEGG   Pyrobaculum sp. 1860: P186_2393Help
Entry
P186_2393         CDS       T01670                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2393
   01230 Biosynthesis of amino acids
    P186_2393
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2393
   00030 Pentose phosphate pathway
    P186_2393
   00051 Fructose and mannose metabolism
    P186_2393
  Energy metabolism
   00680 Methane metabolism
    P186_2393
Enzymes [BR:pyr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     P186_2393
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     P186_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1992866..1994065)
Genome map
AA seq 399 aa AA seqDB search
MKVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGLIIDYFVYNVGDDISLLMTH
TKGEDNPEIHGLAWETFKEVTEQIAKRYKLYGAGQDLLKDAFSGNVRGMGPQVAEMEFEE
RPSEPLIVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEEAYSLLGLIGTTGRYIIRKVFRKADGAPAAANSVERLSLIAGRYVGKDDPVMVVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGAKMTRFDGPP
KVGALGFQLHEGYLEGGVDLFDDPAFDYVRQVAAQVADYIRRMGPFQPHRLPPEEMEYTA
LPKILSKIKAYPADQYEKNRRRYVEAVVKGVKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaacggtttccataattaaagccgacgtaggcggcttcccaggtcacgcccat
gtccacccaaaaatgcttgagtacgccgcggcgaaattgaaagaggcccagaagaggggt
ctcataatcgactacttcgtctacaacgtgggagacgacatatctctactaatgactcac
acaaaaggcgaagacaaccccgagatccacggccttgcatgggagaccttcaaggaggtc
accgagcagatagccaagaggtacaagctgtacggcgcgggccaggaccttttgaaagac
gccttctccggcaacgtcaggggcatgggcccccaggttgcggagatggagttcgaggag
aggcccagcgagccattgatcgtattcgccgccgacaagaccgagccaggcgccttcaac
ctccccctctacaaaatgttcgcagaccccttcaacacagccggcctcgtcatagacccc
tcgatgcacgaaggcttcatattcgaggtgctagacgtagttgagcacaaggtatatctg
ctcaagacgccggaggaggcctactccctcctcggccttataggaaccaccgggaggtat
ataattaggaaagtctttagaaaagccgacggcgcccccgccgccgccaacagcgtcgag
aggctctccctcatagctggccgctacgtcggcaaagacgacccggtgatggtggtcagg
gcgcagtcgggcctgcccgctgtgggggaggtgctcgaggcgttcgcccacccacacctc
gtgcacggctggatgcgcggtagccacgccgggccgttgatgccggcgcgcttcatctca
gtcgatcccgagcggaggatcgccatcggggccaagatgacgcggttcgacgggccgccg
aaggtaggcgccctcgggttccagctccacgaggggtatctggaggggggtgtggacctc
tttgacgacccagccttcgactacgtgaggcaagtcgcggcgcaggtggccgactacatc
aggaggatggggccgttccagccccacagactgccgccggaggagatggagtacaccgcg
ctaccgaagatattatccaagattaaggcgtaccccgccgatcagtatgagaagaatagg
aggaggtacgtggaggctgtcgtaaagggggtgaaggttgaggagtcgcaacacgactag

DBGET integrated database retrieval system