KEGG   Pyrobaculum sp. 1860: P186_2421Help
Entry
P186_2421         CDS       T01670                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    P186_2421
  Amino acid metabolism
   00340 Histidine metabolism
    P186_2421
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     P186_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2017451..2018590)
Genome map
AA seq 379 aa AA seqDB search
MLINRGVGRGMKRGFPRDVLDSVGKIIDEVAGGGLSAALEYSKRLDGIAPENYLITPRPG
GDVEVVSAALTAAESLRRFYEKMTPPSATDYYGGVLRTALWKPVRSVGLYVPARYISTLV
MLAIPAKIAGVDEIYVVTPPRGVTDELLAVARELGVKAVLAIGGPHGLAYAVHHMGVDML
AGPGGLYVQAAKYLLSQHVGIDGIEGPTELVVYAESVAPDTAARGALAQLEHGPTSFAYV
LSPDPQLLRGVEEIYRRERTSSMGSLETRTVSGVEEAVDLIERIAPEHLEVWGRREVAYR
VKNVGAVSVNMPSPYLDYVAGISHVLPTGGSARWRGIVTPLIFMKAVGIAEAVGELALLE
AARKLAEYEGFPLHRRALL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgctaataaataggggggtggggagaggcatgaagagaggctttccgcgggatgtcttg
gattctgttggtaagattattgacgaagtggcgggaggggggctgagcgcggccttggag
tactccaagcggcttgacggcattgctccagagaattacttaatcacgccgagaccgggg
ggagatgtagaggtggtgtctgctgccctaaccgctgcggaatcgctcaggaggttctac
gagaagatgacgcctccatcagcaacagactactacggaggtgtgttgagaacggcactg
tggaaacctgtcagaagcgtggggctgtacgtgcccgcgcgttatatatctactctcgtc
atgctggcgatccccgcgaaaatcgccggggtcgacgagatatacgtcgtgacgccgccc
cgcggcgttacagacgaattgcttgccgtggcgagggagctcggagtcaaggcggtgctc
gccattggaggaccccacggcctcgcctacgcggtgcatcacatgggggttgacatgctg
gcgggccccggcggcttatacgtccaagcggctaagtacctgctgtctcaacacgtcggg
atagacggcatagagggccccaccgagcttgtggtgtacgcagagtccgtagcgcccgac
acggcggccaggggggcgctggctcagctggagcacggccccacctcatttgcatacgtc
ctctcgcctgatccccaactgctgagaggcgtagaggagatatacaggagggagaggacc
tcttcaatggggtcgctggagacgagaacggtctccggcgtggaggaggccgtggatctc
atcgagagaattgcccccgagcacctggaggtgtgggggaggagggaggtggcctacaga
gtcaagaatgtgggcgccgtgtctgtcaacatgccgagcccctatctcgactacgtggcg
gggattagccacgtcttgcccacaggcggctcggcgaggtggcggggcatcgtgacgccg
cttatctttatgaaggccgtcggcatagccgaggctgtgggcgagctggccctgctagag
gccgccaggaagctggcggagtacgaaggcttcccgctccaccgcagggcgttgctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system