KEGG   Pyrobaculum sp. 1860: P186_2447Help
Entry
P186_2447         CDS       T01670                                 

Definition
aldehyde ferredoxin oxidoreductase (aor)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2447
   01230 Biosynthesis of amino acids
    P186_2447
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2447
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     P186_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2037674..2039659
Genome map
AA seq 661 aa AA seqDB search
MIVLEINVESGEVRRRELESTGPLDLALAIHRERETWRLDPLAPEAPVVFGMGPFVGGRL
HGVHRLIFVFKSPQTKTLHVSALGGAAYKAMGMGAHAVAIVGRAPRPTALLIAGGEVKFA
EAEPGDAYEVAKKLYAAHREFFVENDARVLAVGPAAFTTYNGAVVSIDIDAKRGEFRLGA
EDFAARGGPGTALAQGHNVVAVAVGGLKKPLYQKVADVEAINQIFKTKMGKPYLEVLNEK
TVKYRYDPKMGTGGTFGVNYPHYRDLLPLFGYKSIYMTKEERVKHADLVLELFWKPFQVE
VFEKARSWYNCGEPCPVVCKKVWRGKKVDYESFHAVGPFIGNYIFQEAVPLVDKIDRLGL
DAIETGHLVAWLFDAVHAGLLKPEEVGLSDVPAFDPAAFKPVEDSRKNARLAGELIEGFV
NNSTEVLTLVARYGIRKAARELERRYPDRVRAAGHRFRDLAVYAAYGTEGYMTPNFYWAP
GLIGPMYIQGRYWTNYNPTFMPPEDFAKSSYERAVAEAYIDNAGICRFHRGWAEPVLKEL
YSLAGLKPPTPQLYRDIAYYAKLAGAEPMPWESKRARDPVLKELYSLAGLKPPTPQLYRD
IAYYAKLAGAEPMPWESKRARDLVSTLARELGAKEWKFEDYDDYYEWWVRYKEALDKLIF
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtacttgagataaacgtagaaagcggtgaggtgaggaggcgggagttggagtcc
acaggcccgctggacctggcgctcgccatacacagagaacgcgagacgtggcgcctagat
cccctggcgccggaggctccggtggtcttcggcatggggcccttcgtcggcgggaggcta
cacggagtgcacagattgatatttgtcttcaaaagcccccagaccaagacgctacacgta
tccgccctcggaggggcggcttacaaagccatgggaatgggggcccacgcggttgccata
gtggggagggccccgaggcccacagccctcctgatcgcaggcggcgaggtgaagttcgcc
gaggcggagccgggggatgcatatgaagtggccaaaaagctctacgccgcccacagagaa
tttttcgtagaaaacgacgcgagggtactggcggtgggccccgcggctttcaccacgtac
aacggcgccgtggtctccatagatatagacgcgaaaaggggagagtttaggctaggcgcc
gaggacttcgccgctagaggaggcccgggcaccgccctggcccaggggcacaacgtcgtt
gctgtcgccgtggggggcttgaaaaagcctctctaccaaaaggtcgcagacgtcgaagca
ataaaccagatattcaagacgaaaatgggcaagccctacctagaggtgctcaacgaaaag
actgtgaagtacaggtacgaccccaagatggggacggggggcaccttcggggtaaactac
ccgcactaccgcgacctgctacccctcttcggctacaaatccatctacatgaccaaggag
gagagggtaaagcacgcagatctggtgctggagctcttctggaagcccttccaggttgag
gtgtttgaaaaggcgaggagctggtacaattgcggagagccctgccccgtggtttgtaaa
aaagtgtggcggggcaagaaggtggactacgagtccttccacgccgtggggcctttcata
ggcaactacatattccaggaggcggtgccgctggtggacaaaatcgaccgcctaggccta
gacgccatagagacaggccacctagtggcgtggctcttcgacgctgtgcacgccggcctg
ctgaagccggaggaggtggggctgagcgacgtgccggccttcgaccccgccgccttcaag
cctgtggaggactctagaaaaaacgcaaggcttgcaggcgagctgatagagggctttgtg
aacaactcaaccgaggtcctcaccctcgtggctagatacggcattagaaaagccgcgcgg
gagctggagaggcgctaccccgacagagtgagggccgccggtcatagatttagagacctc
gccgtatacgccgcgtacggcacagaggggtacatgacgccgaacttctactgggccccc
ggcttgataggacccatgtacatacaggggcgttactggacaaactacaaccccaccttc
atgccgcctgaagacttcgccaagtcatcctacgaacgcgccgtcgcagaggcctacata
gacaacgcaggtatctgcaggttccacagaggctgggccgagccggtgctcaaggagctc
tactccctagccggcttaaaaccccccaccccccagctctaccgcgacatagcctactac
gccaagctagccggcgcggagccgatgccttgggagagcaaaagagccagagacccggtg
ctcaaggagctctactccctagccggcttaaaaccccccaccccccagctctaccgcgac
atagcctactacgccaagctagccggcgcggagccgatgccttgggagagcaaaagagcc
agagacctagtctccaccctcgcccgcgaactcggcgcaaaagagtggaaattcgaagac
tacgacgactactacgagtggtgggttaggtacaaagaagccctagacaaactgatattc
agctag

DBGET integrated database retrieval system