KEGG   Pyrobaculum sp. 1860: P186_2450Help
Entry
P186_2450         CDS       T01670                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2450
   00020 Citrate cycle (TCA cycle)
    P186_2450
   00620 Pyruvate metabolism
    P186_2450
   00640 Propanoate metabolism
    P186_2450
   00650 Butanoate metabolism
    P186_2450
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    P186_2450
   00680 Methane metabolism
    P186_2450
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    P186_2450
Enzymes [BR:pyr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     P186_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2041183..2041686
Genome map
AA seq 167 aa AA seqDB search
MGGAARGMVTAAQVLATAAILEGKYAQAFPEFGPERRGAPVKSYLRISDRPIYIREPVLH
PDVIVVADQSLFGAENPLEGAKDTSILVVNGVYKAPIKTYYVDATTLAIKVLGRPIVNTA
LIGAVVKATGVVSLGTVAEALKKYFTGRLYDLNVKLVEMAYQETVGL
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggcggccagggggatggtcactgcggcgcaggtcctcgccaccgcggcgatt
ctagaaggcaaatatgcacaagccttcccggagttcggccccgagcgcagaggcgccccc
gtcaagtcctacctacggatctcggacaggcctatatacatcagagagccggtgctccac
ccagacgtaatagtggtggccgaccagtcgctattcggcgcagagaaccccctagaaggc
gccaaggacacctccatacttgtggtaaacggcgtctacaaagctccaataaagacctac
tacgtagacgcgactaccctagccatcaaggttttgggcagacccatagtaaacaccgcc
ctaatcggggctgtggtgaaggccacgggagtcgtgtcgctaggaactgtagccgaggct
ttgaagaagtacttcaccgggaggctgtacgacctcaatgtaaaacttgtagaaatggcc
taccaagaaactgtggggctatga

DBGET integrated database retrieval system