KEGG   Pyrobaculum ferrireducens: P186_2573Help
Entry
P186_2573         CDS       T01670                                 

Definition
(GenBank) 4-alpha-glucanotransferase (malQ)
  KO
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P186_2573
Enzymes [BR:pyr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     P186_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2147465..2148871)
Genome map
AA seq 468 aa AA seqDB search
MLRGAGILLHITSLPGGCYVGDLGPEAYKFAEGLADAGQTYWQTLPINHTLPEYENSPYN
AVSSFAGDPVLISLDLMKKDGLVDQAPQCPATERADYVKAWEVKRAVLEKALKKARALSD
YRNFVDKTPWLEDYAYYMAMRERHGPWGRWPDEAPPRRLVELYKFAQFVFWSQWERLKQY
VNDLGILLIGDLPFYPSVDSVDVWRYRQYFKVGDDGKPLYVAGVPPDYYSATGQLWGNPV
YNWEALERDGYRWWVERLRHMLEVFDYVRLDHFRGYLAYWEIPGGETTAARGRWAPSPGK
RLFDAASAAVELGRLIAEDLGYITPDVEALRDELGLPGMRVLQFAWDGNPANPHKPHNHV
KNSVVYTGTHDNNTAVGWYLQEASPRARREFRQYSNCREAVNWCFIKLAYMSVADVAVVP
MQDVLGLGPEARMNRPGTVGGNWRWRMAKQPEPRQWRRLRSLARLYGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaggggcggggatcctcctccacataacctccctacccgggggctgctacgtg
ggggatctggggcccgaggcgtataaattcgccgagggcctagccgacgccgggcagacc
tactggcagacgctccccatcaaccacaccctgcccgagtacgaaaactctccatacaac
gctgtgtcgagcttcgccggcgaccccgtcctcataagcctagacctcatgaagaaagac
ggcctagtcgaccaggcgccgcagtgcccagcgactgagagggcggactacgtaaaggcg
tgggaggtcaagagggccgtcttggagaaggcgcttaaaaaggcgagggccctcagcgac
tatagaaacttcgtggacaagaccccctggctggaggactacgcatactacatggcgatg
agagagaggcacggcccgtggggccgctggccggatgaggcgccgccgcgccgcctcgtc
gagctgtataaattcgcccagttcgtcttctggagccagtgggagagacttaagcagtat
gtaaacgacctggggatcctcctcatcggcgacctccccttctaccccagcgtagacagc
gtagacgtgtggaggtacagacagtacttcaaagtgggggatgacggcaagcctctttac
gtcgccggcgtgccgccggactactactcagccacgggacaactctggggcaaccccgtc
tacaactgggaggccctcgagcgtgacggctacagatggtgggtggagcggctgagacac
atgctggaggtattcgactacgtgaggcttgaccacttcagggggtacctggcctactgg
gagattcccgggggagagacgacggctgcgagggggaggtgggccccgtcgccggggaag
aggctcttcgacgccgcctcggcggcggtggagctgggaaggctcattgcggaggacctc
ggctacataacccccgacgtggaggcgctgagagacgaactgggcctccccggcatgagg
gtgcttcaattcgcctgggacgggaacccggcaaacccccacaagccccacaaccatgtg
aaaaactccgtggtgtacactggaacccacgacaacaacaccgctgtggggtggtatctc
caagaggcaagcccccgggcccggcgggagttccggcagtacagtaactgcagagaggcg
gtcaactggtgcttcataaagctggcctacatgtccgtcgcagacgtggccgttgtcccc
atgcaagacgtgctggggctgggccccgaggcgaggatgaaccgccccggcacagttgga
ggcaactggcgctggaggatggcaaagcaaccggagccacgccagtggaggaggctgagg
agcctagcccggctctacgggcgttga

DBGET integrated database retrieval system