KEGG   Pyrobaculum sp. 1860: P186_2632Help
Entry
P186_2632         CDS       T01670                                 

Definition
malate synthase (glcB)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2632
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P186_2632
   00630 Glyoxylate and dicarboxylate metabolism
    P186_2632
Enzymes [BR:pyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     P186_2632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2195939..2198380
Genome map
AA seq 813 aa AA seqDB search
MIEINPLVVKNYGDLLGVKTVNNREVSVEGLIEELTREFRDEIDRVIKARREWLNDKRPV
RVKAAFPSWDEKFVDADGNVRTFREIVQGLIDNLLGRDTPLRWGLNWNTPVPDDLHPLKN
PGLEITGPWHPMSRAIHQINADVASMMEDEEDASPAWYVPRGSGRAVAAVWEARRVVNRV
LRGDVPQPYYEGGKEYRLRKPRERWPTLIHRVPGLHILDFDIRVDGKPATAIITSIVLYA
VNNYDLLKRAGSGVYFYVPKVQTADEALVVEKILRRVEDRLGLRRGELKIAMLYEEARAG
LHLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPIMMAYQKYNAL
MCLMAGLGRDGRLNAGPVGGMAAVMLYRPDDPYQRNRFNARALRAIWLDKLRERLIGLIF
YTEEPVKKVALKDILEGKVRGRLYDLFRQSWVATPEESYVKAGNEPLRASLEELQAMINR
PVKYVEVDGVKIPAVDSGLTEQERALFQRLGLIDEAGNITPWVIRPDMLDTPEKLFNNPE
LWGGRDLWTALYEPPKGDITAEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMNDL
ATYRIFSTWLWTLLRHKAAVTKDGAFKGPGRTSLGVIPAEDRVKIPAGTRFTEELFDKLW
DLHMEWTYAFYDDLDRIAAERVLARFAGDVKKILAEAYRAGPFRYLSPREAAKRIAEAVR
VEEVERAVVENQPRFDRSFAPVIMEILKTKLKSPMYLQHGGRMIMALSPLPDEERDLVLR
ALFTPRVEVERMVKEGRLKPFVLELYDYIHDIR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
gtgattgagataaacccacttgtagttaaaaattacggagatttgcttggcgttaagact
gttaataatagggaggtttctgttgagggccttatagaagagttgacacgtgagtttcgc
gatgagatagatcgcgttattaaggccaggagagagtggcttaacgacaagaggcctgtt
agagttaaagccgcgtttcccagctgggatgagaaatttgtcgacgccgatggtaatgtg
aggacttttagggaaatagtccaggggctaattgacaacctccttggccgggacacgcca
ttgaggtggggcctaaactggaacacgccagtgccagatgatctccacccattgaaaaat
ccagggcttgaaatcacggggccctggcaccccatgagcagagcaattcaccagataaac
gccgatgttgcgtccatgatggaggacgaggaggacgcctcgccggcgtggtacgtcccg
cggggctccggccgcgcggtggccgctgtgtgggaggcgcggagggttgtaaaccgggtt
ctgcggggggacgtgccgcagccgtattacgagggggggaaggagtacaggttgaggaag
ccgagggagaggtggccaactcttatacaccgcgtccccggcctccacatcttggacttc
gacataagggtagacggcaagccggccacggccataatcacctctattgtgctctacgct
gttaataactacgacttgttgaagagggcgggctccggcgtctacttctacgtgcctaag
gtgcagaccgccgacgaggctttggttgtggagaagatcctccgccgcgtggaagacagg
ctggggctgaggcgcggcgagttgaaaatcgcgatgctttacgaagaggctagggccggc
ctgcacctacctgtcatcttctggatttggagagagaggcttgtgaagagcaacaacggg
cgctgggactacctcggctctctcatagagatgtggaaagacgaggcggtgtaccccgac
ccccagaacatcaccatgacgcaccccatcatgatggcgtaccagaagtacaacgccctt
atgtgcctaatggcgggcctcggcagagacgggaggctaaacgccgggccggtgggcggc
atggccgcggttatgctgtacaggccggacgacccctaccagagaaaccgcttcaacgcc
agggcgcttagggccatatggctggacaagcttagggagaggcttataggcctcatcttc
tacacagaggagcccgtcaaaaaggtggcactgaaggatatactagagggcaaggtgagg
gggaggctgtacgacctgttccgccagagctgggtggcgacccccgaggagtcctacgtc
aaggctgggaacgagccgctgagggctagtctagaggagctacaggccatgataaacagg
ccggttaaatacgtggaggtagacggagtcaagataccggctgtcgacagcgggttgaca
gaacaggagagggccctcttccagaggctgggtctcatagacgaggccggcaacataacg
ccgtgggtaatacgccccgacatgctggacactccggagaagcttttcaacaacccagag
ctgtggggcgggagggatctgtggactgccctatacgagccgcctaagggcgacatcacg
gccgagcacatccagcacgccttctacatggcggctaactacggctttcagctcctcaac
ggcaacctagccgccgccatagacgactacgagctaggccagaggtttatgaatgacctc
gccacctaccgcatattctccacctggctgtggactctcctgcgccacaaagccgccgtc
acgaaagacggcgcgtttaaggggcctgggaggactagcctcggagtaataccggccgag
gaccgggtcaagatacccgccggcacgcgcttcaccgaggagctgtttgacaagctgtgg
gatctccacatggagtggacctacgccttctacgacgacctcgaccgcatagccgcagaa
cgcgtgctggcccgcttcgccggggacgtcaagaaaatcctagccgaggcatacagggct
gggccgtttagatacttgtcgcctagggaggcggcgaagagaatcgcagaggcggtgcgg
gttgaggaggtggagagggccgttgtggagaaccagccgaggtttgacaggtccttcgcc
cctgtgattatggagatactaaagacaaagctgaagtctccaatgtatctacaacacggc
ggcaggatgataatggcgctgtcgccgttaccagatgaagagagagacctcgtgctcagg
gcgctgttcacacctagagtggaggtagagagaatggtcaaggagggcaggttaaagccc
tttgtcctcgagctgtacgactacatacacgacattagataa

DBGET integrated database retrieval system