KEGG   Pyrobaculum sp. 1860: P186_2691Help
Entry
P186_2691         CDS       T01670                                 

Definition
aminopeptidase from family M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P186_2691
Enzymes [BR:pyr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     P186_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2253097..2254185
Genome map
AA seq 362 aa AA seqDB search
MEEFIQLLKRLSEARGPSGFEDEVREVVVREMEPYVDEVVVDRWGNVIGIKRGASERRAM
VAAHIDEIGLMVDHIDKEGFLRFRPVGGWNEVTLVGQRVWVKTSRGTWIRGVVGSTPPHV
TPAGKEREAPEIKDLFIDIGASSREEVEKLGVEVGSVAVLDREFAVLNGRVVTGKAFDDR
VGVAVLLYALRQLKELPTTLYAVATVQEEVGLRGAQIAAERINPHYAIALDTTIAADVPG
VGDRLHVTKIGKGPAIKVLDGGRGGLFIAHPQLRDHIVKIARDIGVPYQLEVLYGGTTDA
MAIAFRREGIPAATISIPTRYIHSPVEVLNVEDAVNASKLLKAVLERTTPAVIDSFLDKR
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaggagttcatccaactcctaaaaaggctttcagaggcgagggggccctccggcttt
gaagacgaggtaagggaggtcgtggttagggaaatggagccgtatgtcgacgaggtggtg
gtggatcggtgggggaatgtaattgggattaagcggggcgcctcggagcgccgcgccatg
gtggctgcccacattgacgagattggcctcatggttgatcacatagacaaggaggggttc
ctcaggtttagaccagtcggaggctggaacgaggtgactctcgtgggccagagggtgtgg
gttaaaacttcccgcggcacgtggatccgaggcgtcgtgggctccacacctccccacgtc
actccggcgggcaaggagagggaggcgcctgagatcaaggacttgtttatagacatcggg
gcttctagcagagaggaggtggagaaattgggcgtggaggtgggctccgtggctgtgctc
gacagggagttcgccgtgctgaacggcagggtggtcaccggaaaggctttcgacgaccgg
gtaggcgtagccgtcctgctgtacgccttgagacagttgaaagaattgccgacgactcta
tacgccgtggccaccgtacaggaagaggttgggctccgtggggcgcagattgcggctgag
aggataaacccccactacgcaattgcgctcgacacgactatagcggcggacgtgccgggg
gtgggggataggctacacgtcaccaagatcggcaagggccccgccattaaagtcctcgac
gggggtcgcggggggctctttatagcgcacccccagctgagggaccacattgtgaaaatc
gccagggatataggggttccgtaccagctggaggttctgtacggaggcaccaccgacgcc
atggcaatagcgtttaggcgtgaggggataccggcggcgacgatatctatacccacccgc
tacatccactcgcctgtagaggtgctcaacgtagaggacgccgtcaacgcctctaaactc
ttgaaagcggtgttggagaggaccacccccgcggtgatagacagcttcctagacaagagg
attaagtag

DBGET integrated database retrieval system