KEGG   Pyrobaculum ferrireducens: P186_2691Help
Entry
P186_2691         CDS       T01670                                 

Definition
(GenBank) aminopeptidase from family M42
Organism
pyr  Pyrobaculum ferrireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2253097..2254185
Genome map
AA seq 362 aa AA seqDB search
MEEFIQLLKRLSEARGPSGFEDEVREVVVREMEPYVDEVVVDRWGNVIGIKRGASERRAM
VAAHIDEIGLMVDHIDKEGFLRFRPVGGWNEVTLVGQRVWVKTSRGTWIRGVVGSTPPHV
TPAGKEREAPEIKDLFIDIGASSREEVEKLGVEVGSVAVLDREFAVLNGRVVTGKAFDDR
VGVAVLLYALRQLKELPTTLYAVATVQEEVGLRGAQIAAERINPHYAIALDTTIAADVPG
VGDRLHVTKIGKGPAIKVLDGGRGGLFIAHPQLRDHIVKIARDIGVPYQLEVLYGGTTDA
MAIAFRREGIPAATISIPTRYIHSPVEVLNVEDAVNASKLLKAVLERTTPAVIDSFLDKR
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaggagttcatccaactcctaaaaaggctttcagaggcgagggggccctccggcttt
gaagacgaggtaagggaggtcgtggttagggaaatggagccgtatgtcgacgaggtggtg
gtggatcggtgggggaatgtaattgggattaagcggggcgcctcggagcgccgcgccatg
gtggctgcccacattgacgagattggcctcatggttgatcacatagacaaggaggggttc
ctcaggtttagaccagtcggaggctggaacgaggtgactctcgtgggccagagggtgtgg
gttaaaacttcccgcggcacgtggatccgaggcgtcgtgggctccacacctccccacgtc
actccggcgggcaaggagagggaggcgcctgagatcaaggacttgtttatagacatcggg
gcttctagcagagaggaggtggagaaattgggcgtggaggtgggctccgtggctgtgctc
gacagggagttcgccgtgctgaacggcagggtggtcaccggaaaggctttcgacgaccgg
gtaggcgtagccgtcctgctgtacgccttgagacagttgaaagaattgccgacgactcta
tacgccgtggccaccgtacaggaagaggttgggctccgtggggcgcagattgcggctgag
aggataaacccccactacgcaattgcgctcgacacgactatagcggcggacgtgccgggg
gtgggggataggctacacgtcaccaagatcggcaagggccccgccattaaagtcctcgac
gggggtcgcggggggctctttatagcgcacccccagctgagggaccacattgtgaaaatc
gccagggatataggggttccgtaccagctggaggttctgtacggaggcaccaccgacgcc
atggcaatagcgtttaggcgtgaggggataccggcggcgacgatatctatacccacccgc
tacatccactcgcctgtagaggtgctcaacgtagaggacgccgtcaacgcctctaaactc
ttgaaagcggtgttggagaggaccacccccgcggtgatagacagcttcctagacaagagg
attaagtag

DBGET integrated database retrieval system