KEGG   Pyrobaculum ferrireducens: P186_2792Help
Entry
P186_2792         CDS       T01670                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pyr  Pyrobaculum ferrireducens
Pathway
pyr00010  Glycolysis / Gluconeogenesis
pyr00051  Fructose and mannose metabolism
pyr00562  Inositol phosphate metabolism
pyr01100  Metabolic pathways
pyr01110  Biosynthesis of secondary metabolites
pyr01120  Microbial metabolism in diverse environments
pyr01130  Biosynthesis of antibiotics
pyr01200  Carbon metabolism
pyr01230  Biosynthesis of amino acids
Module
pyr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2792
   00051 Fructose and mannose metabolism
    P186_2792
   00562 Inositol phosphate metabolism
    P186_2792
Enzymes [BR:pyr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P186_2792
Exosome [BR:pyr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P186_2792
  Exosomal proteins of bladder cancer cells
   P186_2792
  Exosomal proteins of melanoma cells
   P186_2792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG His_biosynth NMO FMN_dh IGPS Smr
Motif
Other DBs
NCBI-ProteinID: AET34168
UniProt: G7VF03
Position
2351041..2351715
Genome map
AA seq 224 aa AA seqDB search
MKFPILIINFKSYKEAAGPRAVEIAKAAERAAKELGVNIAVAPNHFELALVAQSVEIPVY
AQGVDVESAGAYTAHTALENVKEVGASGVILNHSEAPLRLNDLGRFIPKARALGLDVVTC
APDPRTSLAAAALGPSAVAVEPPELIGTGKAVSKYKPETVVETVQLVSKHFPDVAVITGA
GIESGEDVEAALRLGTKGVLLASAAVKAKNHYQKIMELAKPLVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccccatactaatcataaatttcaaatcatacaaggaggccgccgggcccagg
gctgtggaaatagcaaaagccgccgagagagctgcaaaggagctgggggtaaacatagcc
gtggctcccaaccacttcgagctcgccctagtcgcccagtctgtggaaattccggtctac
gcccagggcgtcgacgtcgagagcgccggcgcctacacggcccatacggcgcttgaaaac
gtcaaggaggtgggggcctccggggttattctaaaccacagcgaggcacccctccgccta
aacgatctaggcagattcatccccaaggcgagggcgctggggctcgacgtggtgacgtgc
gcccccgacccgaggaccagcctcgccgcggccgccctggggcccagcgcggtggcggtg
gagccgccggagctaataggcaccggcaaggcggtctctaaatacaagccagaaaccgtc
gtggagactgtgcaactggtaagcaaacacttccccgatgtcgccgtcatcaccggcgcc
ggtattgaaagtggtgaggacgtggaagccgcgctgaggctaggcaccaagggggtgttg
ctggcgagcgccgcggtcaaggcgaagaaccactaccagaaaataatggagctggcgaag
cccctggtgaggtag

DBGET integrated database retrieval system