KEGG   Pyrobaculum sp. 1860: P186_2792Help
Entry
P186_2792         CDS       T01670                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pyr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    P186_2792
   01230 Biosynthesis of amino acids
    P186_2792
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P186_2792
   00051 Fructose and mannose metabolism
    P186_2792
   00562 Inositol phosphate metabolism
    P186_2792
Enzymes [BR:pyr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     P186_2792
Exosome [BR:pyr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   P186_2792
  Exosomal proteins of bladder cancer cells
   P186_2792
  Exosomal proteins of melanoma cells
   P186_2792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2351041..2351715
Genome map
AA seq 224 aa AA seqDB search
MKFPILIINFKSYKEAAGPRAVEIAKAAERAAKELGVNIAVAPNHFELALVAQSVEIPVY
AQGVDVESAGAYTAHTALENVKEVGASGVILNHSEAPLRLNDLGRFIPKARALGLDVVTC
APDPRTSLAAAALGPSAVAVEPPELIGTGKAVSKYKPETVVETVQLVSKHFPDVAVITGA
GIESGEDVEAALRLGTKGVLLASAAVKAKNHYQKIMELAKPLVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccccatactaatcataaatttcaaatcatacaaggaggccgccgggcccagg
gctgtggaaatagcaaaagccgccgagagagctgcaaaggagctgggggtaaacatagcc
gtggctcccaaccacttcgagctcgccctagtcgcccagtctgtggaaattccggtctac
gcccagggcgtcgacgtcgagagcgccggcgcctacacggcccatacggcgcttgaaaac
gtcaaggaggtgggggcctccggggttattctaaaccacagcgaggcacccctccgccta
aacgatctaggcagattcatccccaaggcgagggcgctggggctcgacgtggtgacgtgc
gcccccgacccgaggaccagcctcgccgcggccgccctggggcccagcgcggtggcggtg
gagccgccggagctaataggcaccggcaaggcggtctctaaatacaagccagaaaccgtc
gtggagactgtgcaactggtaagcaaacacttccccgatgtcgccgtcatcaccggcgcc
ggtattgaaagtggtgaggacgtggaagccgcgctgaggctaggcaccaagggggtgttg
ctggcgagcgccgcggtcaaggcgaagaaccactaccagaaaataatggagctggcgaag
cccctggtgaggtag

DBGET integrated database retrieval system