KEGG   Pyrobaculum sp. 1860: P186_2868Help
Entry
P186_2868         CDS       T01670                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pyr  Pyrobaculum sp. 1860
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pyr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2417548..2418111
Genome map
AA seq 187 aa AA seqDB search
MITEKRAKARPEKGVEDLLLHLGEDLSRPGVANTPRRFVKAMEELTRGLREPPPEVVFFP
LEYEAQVGPVVIENIGAVSVCEHHLLPILLRVSVAYIPGDGVPGLSKVIKLVKWAAARPI
MQERFTEWLADLLMERLRARAVKVRVCGVHMCSFIRGARDEHHNMVTEARRGDIDVRLSC
RRPLSCR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgattaccgagaagagggccaaggcgaggcctgagaagggcgtcgaggacctccttctc
cacctcggcgaggacctctcccggccgggggtggccaatacgcctaggcgctttgtgaag
gctatggaggagctgacgcgggggcttagggagcctccccccgaggtggtcttcttccca
ctggaatacgaggcgcaggtggggcctgtggttattgagaatataggcgccgtgtctgtc
tgcgagcaccacctactccccatcctcctccgggtgtcggtggcgtacatcccgggggac
ggggtgccggggctgagcaaggttattaagcttgttaagtgggccgcggcgaggccaatt
atgcaggagcgcttcaccgagtggctggccgatctcttaatggagaggctgagggcgcgg
gccgtcaaagttagggtgtgtggagtgcatatgtgctccttcatccggggtgcgagggac
gaacaccacaacatggtcaccgaggcgaggagaggcgacatcgacgtgaggctgagctgc
cgcaggcccctgtcttgcagatga

DBGET integrated database retrieval system