KEGG   Pyrococcus sp. ST04: Py04_0002Help
Entry
Py04_0002         CDS       T02124                                 

Definition
N-acetlyltransferase (GNAT) containing protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pys  Pyrococcus sp. ST04
Brite
Enzymes [BR:pys01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Py04_0002
Transfer RNA biogenesis [BR:pys03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Py04_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1143..2906)
Genome map
AA seq 587 aa AA seqDB search
MKEEAIKEIVDLLLEGRIRDREELNKIKIEVARKYHLSRLPRNSEIWRALPKERREEFRD
LLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGKEPSALRAAQYGY
HPYIIMMARLKQLYDIGHPIDKVEVIIQGGTFPAVDLDYQEWFIKCAFKAMNDFPYFKDI
DNLEEKLVRFILQGDESVLEEDPEFKKAWERTHRKKYYYLEDEQRKNEKAKVRMVGLTIE
TRPDWAFERQIDRMLSFGTTRVELGVQTIFNFIHERTKRGHGVEEIVKATQLLRDAGLKI
NYHIMPGLPGSNFERDLYTFKTIFEDPRFRPDMLKIYPTLVTRDAPLYAWYKAGLYKPYT
TEEALELLVEAYKIFPKWVRVMRIQRDIPAHLIVAGVKHSNLGQLVFEELIKRGIRPREI
RFREVGHQMQKFGKVPEVEHIKLLREDYEAAGGMEIFLSFEDVKNDILIGFLRLRIPSER
AHRKEINCCPSAIVRELHVYGPLVPIGEKPKYEWQHRGYGRELLAEAERIAREEFDAKKM
LVISGVGVREYYRKFGYRKDGPYVSKRLDRRYADYGKSDKFDAHLNT
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggaagcaattaaagaaattgttgaccttctacttgaagggaggattagagat
agggaggaacttaacaagataaagatagaggttgctaggaaatatcatctctctagactt
ccgaggaactctgagatctggagagctcttcctaaggaaagaagggaagagtttagggat
ctccttaagaagaagccgacgaggactattagtggcgttgctgtagttgcgatgatgaca
aagccttttccatgccctcatgggagatgcatttactgtcctgggggtccttccgttgga
tcacctcaaagctatactggaaaggagccctctgcacttagggctgctcaatatggctat
catccgtacataataatgatggcgagattgaagcaactctacgatattggtcatccaata
gataaagttgaagttataattcaagggggaacttttccagccgttgaccttgattatcaa
gagtggtttataaagtgtgcattcaaggctatgaatgacttcccctacttcaaagatata
gacaacctcgaagaaaagttagttagatttattcttcaaggagacgagtctgttcttgaa
gaagacccagagtttaagaaagcctgggaaaggacacacaggaaaaagtactactacctt
gaagacgaacagaggaagaacgagaaggctaaagttagaatggtgggtttgacaatcgaa
acaagacctgactgggcctttgagaggcagatagataggatgctctcctttggaacgaca
agggttgagctgggagttcagactatattcaatttcatccatgagagaaccaagaggggt
cacggcgttgaggaaatcgtgaaggccacacaacttcttagggatgctggacttaagata
aactaccatataatgcctggtcttcctgggagcaactttgagagggatctatacacattt
aagactatttttgaagacccacgatttagaccggacatgctaaagatatatcccaccctc
gttacgagggatgctcccctatatgcttggtacaaggccggtctctataagccatataca
actgaggaggcgttggagcttctggttgaggcatataaaatatttccaaagtgggttagg
gtaatgaggattcagagagacatacctgctcatctgatagttgccggtgttaagcactca
aacctgggtcagctagtctttgaagaattaataaagagagggatcaggccaagagaaatt
cgctttagggaagttgggcatcagatgcaaaagtttggaaaagtgcctgaggttgagcac
ataaagttgcttagggaagattatgaagccgctggcgggatggaaatattcctcagtttt
gaagatgttaagaatgacattctgataggatttctaaggctgaggattcccagtgagaga
gctcataggaaggagataaattgttgcccctcagctatagttagggagcttcatgtgtat
ggacctttggttccaataggggagaagcccaaatatgagtggcaacatcgcggatatgga
agagagttactggctgaggcagaaagaattgcaagggaggagtttgatgctaagaagatg
ctcgtcataagtggggttggtgtgagggagtactataggaagtttgggtacaggaaggat
ggtccatatgtcagtaagaggctcgacaggagatacgctgattatggaaagagtgataaa
tttgacgctcacctaaatacttag

DBGET integrated database retrieval system