KEGG   Pyrococcus sp. ST04: Py04_0018Help
Entry
Py04_0018         CDS       T02124                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pys  Pyrococcus sp. ST04
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pys00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Py04_0018
   01230 Biosynthesis of amino acids
    Py04_0018
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_0018
   00051 Fructose and mannose metabolism
    Py04_0018
   00562 Inositol phosphate metabolism
    Py04_0018
Enzymes [BR:pys01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Py04_0018
Exosome [BR:pys04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Py04_0018
  Exosomal proteins of bladder cancer cells
   Py04_0018
  Exosomal proteins of melanoma cells
   Py04_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(16693..17382)
Genome map
AA seq 229 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLADLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKKVNPDVKVL
CGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGIIKKD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcttaaggagccaattattgctataaactttaagacatatattgaagcgact
gggaagagagctcttgaaatagccaaagccgctgagaaagtatacaaagaaacaggggta
acaatagtagttgctcctcagcttgctgaccttagaatgattgcagagagcgttgagatc
ccagtttttgctcagcacattgacccgataaagcctgggagccatactggtcatgtgctc
ccagaggcagttaaagaggccggagccgtcggaacgctcttaaaccactcagagaacagg
atgattcttgctgatcttgaagctgcaataaggagggctgaagaggttggcctcatgaca
atggtctgctctaacaatccagcagtaagtgcggcagttgctgccttaaatccagattat
gtggctgttgagcctccagagcttataggaaccgggatacctgttagcaaggcgaagccg
gaggtaattactgataccgttgagctcgttaagaaggtgaacccggacgttaaggttctc
tgtggggcaggtatttcaactggcgaggatgttaagaaggctatagaacttggaacggtt
ggtgttttgctagcaagtggggtcactaaggctaaggatccagagaaggccatttgggat
ctagtctctggaataataaagaaagattag

DBGET integrated database retrieval system