KEGG   Pyrococcus sp. ST04: Py04_0020Help
Entry
Py04_0020         CDS       T02124                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pys  Pyrococcus sp. ST04
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(18097..18756)
Genome map
AA seq 219 aa AA seqDB search
MREEELYEKWKRTVEMLEWEGIIKSKEVKEAFLKYPRYLFVEDRFKRYAHLDEPLPIPAG
QTVSAPHMVAIMLELAKLKPGMNVLEVGTGSGWNAALISYLVKNDVYTIERIPELVEFAK
KNLERAGVKNVHVILGDGTKGFPPKAPYDVIIVTAGAPKVPEPLVEQLKPGGKLIIPVGS
YHMWQELLEVVKGKDGSVEIKKRGGVAFVPLIGEYGWKE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagggaggaagagctatacgaaaaatggaagagaactgtcgaaatgcttgagtgggag
ggaataattaaaagtaaggaggttaaagaagcttttctaaagtatccgaggtaccttttt
gttgaggataggttcaagaggtatgctcatctcgatgaacctcttccaattcctgctggt
caaactgtatctgctccccatatggttgctataatgcttgaactcgccaagttaaagcct
ggaatgaacgttcttgaagtcggaactggaagtggatggaatgcggctctcatttcttac
ctcgttaaaaacgatgtttacacaattgagagaatccccgaacttgtcgaattcgcaaag
aaaaatcttgaaagggctggagtaaagaatgttcatgtaatccttggggatggtaccaag
ggatttcccccaaaggcaccttatgatgtcataatagttaccgcgggagcacctaaagtt
ccggaaccacttgtcgagcaacttaagcccgggggtaagcttataatccccgtggggagc
tatcatatgtggcaggagcttctcgaggtagtaaagggtaaggatgggagtgttgaaatt
aaaaagagagggggagtagcttttgtccctctaataggagaatatgggtggaaagaatga

DBGET integrated database retrieval system